KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4573Help
Entry
EC042_4573        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS-SciN Lipoprotein_22
Motif
Other DBs
NCBI-ProteinID: CBG37393
UniProt: D3GUZ9
Position
4902569..4903120
Genome map
AA seq 183 aa AA seqDB search
MTIKCLLLAVMVCPFFITACSDKYSEQDRVQAINNADAPFGAGLLTFQISSDTQLNSLNE
ISNSCALLFLQASDKNTLQDIMNNPVLIKQFFIGTGKVDGILKVDKYVAMPGQEITLHID
RNEGTKYVGVVAGYYPFPGKQHMLLLDIPVDVVEEGWWNKSLHASLLPLSKKISMGKESI
SMK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgactattaagtgcctgctactagcggttatggtatgcccctttttcatcactgcctgt
tctgataagtattctgaacaggatagagtgcaggctatcaacaatgccgatgctccattt
ggcgccggcttgcttacttttcagatatcatctgatacgcaattaaactcacttaacgag
atatccaacagctgtgcattattattcttacaggcttcagataaaaatacattacaggac
ataatgaataatcctgtgttaatcaaacagttttttatcgggacaggtaaggttgatggc
attcttaaagttgataaatacgtggctatgccggggcaggagataacgctacatatagac
aggaatgaagggactaaatatgtaggtgtggttgctggatactatccatttcctggaaaa
cagcatatgttactcttagatattccggttgatgttgttgaggaaggttggtggaataaa
tcattacatgcatcactcttacctctttccaaaaagatatcgatgggtaaagaaagtatc
agtatgaaataa

DBGET integrated database retrieval system