KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4575
Entry
EC042_4575        CDS       T02067                                 

Name
(GenBank) putative type VI secretion protein
  KO
K11892  type VI secretion system protein ImpK
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_4575
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4575
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4575
SSDB
Motif
Pfam: DotU
Other DBs
NCBI-ProteinID: CBG37396
UniProt: D3GV02
Position
4904890..4905480
AA seq 196 aa
MNIVECYMPVFKLISSVRVFPEEYSDYDSTRKNIINTVEEAVRNSEKMSLSDSELDAAFY
AVIVMLDEAILCSELPCRKEWRDNLLQIKYFGHSTGGVEFFYKLDKVIESGSQAGWVFLL
CLLLGFRGKYSVGSNDEINNYISRLRRQCELNVAIDEGNNISLREKKYKSSRLGFYLLLV
GIVAVYFVVLSMIYMR
NT seq 591 nt   +upstreamnt  +downstreamnt
gtgaatattgttgaatgctatatgccagtatttaaactcatatcatctgtcagagttttc
cctgaagaatatagtgattacgacagtactagaaagaatataattaacactgttgaggag
gctgttcgcaatagtgaaaaaatgtcgttgagtgacagcgaacttgatgcggcattttat
gctgtaatcgtcatgcttgatgaggcaatattgtgttcagagcttccctgtagaaaagaa
tggcgtgataatcttttgcagataaaatatttcggacactccactgggggggtcgagttc
ttttataaacttgataaagtcatcgaatcgggaagtcaggctggatgggtctttctcctg
tgcctgttactgggtttcagaggtaaatattccgtgggtagtaatgatgaaatcaataat
tatatatcgaggctgaggcgacaatgtgaattgaatgttgcaatcgacgaaggaaacaat
atttcactcagggaaaaaaagtataaatcatcgaggcttggtttctatttattacttgta
ggtattgttgctgtctattttgtggttttatccatgatttatatgagatga

DBGET integrated database retrieval system