KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4576
Entry
EC042_4576        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
  KO
K11891  type VI secretion system protein ImpL
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_4576
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4576
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4576
SSDB
Motif
Pfam: IcmF-related_N
Other DBs
NCBI-ProteinID: CBG37397
UniProt: D3GV03
Position
4905477..4908890
AA seq 1137 aa
MIFMLKKTFSLFLWFFVSVFVLSVCYVIGVFRNWTDTTTALYWISVILVTLSFKFIMDCI
HNYFSAGKYRNFLKSFSRKKRALTLDSYFKKGLNIISKRGRGEVPWFLLTGDSEKNNSLL
EDINLPVFHRNCVNSTPQQFRTIRWWFFRDLSVLELSGKIYDNPGVINSVISSLSARKCK
KQPPRGVVLVISADKLINHDYTYIRTLSQKTRSFVEQLSLHLHHNIPVFIVISGCEHISG
YSVLAQKIYQKHEKWHPVFWATNKSGTNASEYDSSYILSSLRSNIMASICHALDDSLSDK
EKNDILQFPDRLKGLKYSLDIFISTFCIENVFFSQTEIAGICLSGELMGEKDKNCIFADI
LISEILPQIHDSDVIHVNKQRVNVSFKSVIAMTALCFVGYSGYCSYNVYNIRHGSVDTSH
AFLTEQISKYEDKVRSNMRYFPFKPALDDKYLFFRESLHKTTRFDISPVSWRVTEYKKNF
MQASPSGKRELILSLSSSLISWDKMMKDESLSDLAKSPGIHELLKITRPHDKISSIASLA
VERDEIQKNNGIENIYVFRNLLTELVQSDPSYSWFVSEDVNIPAVRITDFWEDENSSVYL
SGIWTQPGQNKLHQWYETIKEAYGRDTVPEAFSSFVLYLDESRQEHFRQFIMSVARARKD
SHSGLMNPLQLTNIIHNRSSEHRFFQFVDDELHNIPTSSAQDWLSEFRLLNHLFSLKVDN
GMKRQIEQFDLMLRIYLISVLNNSQMNRTLTHVTTWRSWQNALRNAVNSVLHTASSVELI
RNAMRSDPENKLVILFDEFEKVRSVINSNNREPVIDSVWDIYERQIYQLLDHAVTYTGCW
VGEQWRNSVLGRFNSGKHNLSYSEMQGKVYKDIIGFLKGPSNGVLALDPDGVRLLSFRER
SIPFSPSFITFINDIVSPDDLLDVWLRERTQNKDELINVQGQLDLLNQTLQNAESQPYRV
TIDSAPATIPDNPRVKPTGTTLTLECKTGNSSIRSMNFADSGIFTWYPGSCHSVRIDILF
PNFSATYKFTGETAWIDFINKFSDGESELMTKDFSPESRNFLESMGIKGILVRYKLSDTG
NLSQAYIEWEQLKQEKDKLKDLQVNLSNKLLTTHSWEKSAWISRLPGNITICPVVQE
NT seq 3414 nt   +upstreamnt  +downstreamnt
atgatttttatgcttaagaagacattttcattatttctctggttttttgtttctgtcttc
gttctgtctgtttgctatgttatcggcgtgttcagaaactggacagatactacaactgca
ctttactggatttctgtgattcttgttactctttcctttaaatttattatggattgtatc
cataattacttttctgcaggaaaatacagaaattttctaaagtctttctctcgtaaaaag
agagcattgacgcttgattcgtatttcaaaaaaggtctgaatatcataagtaaaagggga
agaggagaggttccttggttcttacttacgggagattcagaaaaaaacaactctttgctt
gaagatatcaatcttcctgtctttcaccgtaattgtgtaaatagcactccccaacaattc
cggacaattcgttggtggtttttcagagatttaagcgtgctggagttgtcaggaaagata
tatgataacccgggagtaataaactctgtgataagttctttatcagcacgtaaatgtaaa
aaacagccacctcgtggcgttgttctcgtcatttctgctgataagctaattaatcatgat
tacacctatattcggacattgtctcaaaaaacaaggagttttgtagaacaactgtcgtta
cacttacatcacaacattccggtctttatagtgattagtggatgtgagcacatcagtgga
tattcagtgctggcacaaaaaatctatcaaaaacatgaaaaatggcatccagtgttttgg
gcaaccaataaatcagggacgaatgcatctgaatatgattcatcatacatattatcatca
ttaagatctaatataatggcatcaatatgccatgcgcttgatgattcattaagtgacaag
gaaaaaaatgatatactgcagtttcctgatagattgaaaggtctaaagtattcacttgac
atatttatttccacattctgtattgagaacgtttttttctctcagacggaaattgccggg
atctgtttatctggtgaactcatgggggagaaggacaaaaactgtatttttgctgatatc
cttatttccgagatactgccacaaatacatgattcagacgttattcatgttaacaaacaa
agagtgaatgtatcgtttaaatcagttatagccatgactgcattgtgttttgttggatat
agcggatattgttcatataatgtgtataacatcagacatggttctgttgataccagccat
gcatttctgacagagcagatatcaaaatatgaagacaaagttaggtctaacatgcggtat
ttcccttttaagcctgcactagatgataaatatctatttttcagagaatctcttcataaa
acaacaagattcgatatcagtcctgtctcatggcgcgttactgaatataagaagaatttc
atgcaagcttcaccatcaggaaagcgagaactaattctgtcgctctcatcatcacttatc
agttgggataagatgatgaaagatgaatccctgagtgacttagcaaaatctcctggtatt
catgagttactgaagataaccagacctcatgataaaatatcatcaatagcttcacttgct
gtagaaagagatgagatacagaaaaataatggaattgagaatatttatgtgttcagaaac
ctcctgactgagttggttcagagtgacccgtcttattcatggtttgtttctgaagatgtt
aatattcctgctgtaagaattacggacttttgggaagatgaaaactcttctgtctatctt
tccggaatatggacacaaccgggacagaataaacttcatcagtggtatgagactatcaaa
gaggcatatggacgtgatacggttccggaggcgttctcatcctttgtgctatacctggat
gaaagtcgtcaggagcatttcagacagtttattatgtctgttgcaagggcacgtaaagac
tcacattcaggtttaatgaatccgctgcaactgaccaatattatacacaatcgctcatct
gagcatagattctttcagtttgtagatgatgaattacacaatataccaacgagttcggcg
caggactggctttctgaattcagactgcttaaccatctgttttcacttaaagtggataac
ggaatgaaacgtcaaatagaacaatttgatctcatgttacgtatatacctgatttctgtt
cttaataacagtcaaatgaacaggacactgactcatgttaccacatggagaagctggcag
aatgctctacgtaatgccgtgaattcagtgttacatacagcatcatcagttgaacttatt
cgtaatgccatgcgttcagatccagaaaacaagctggtaatattatttgatgagtttgaa
aaggttcgctcagtcattaacagcaataatagagagccggtgattgattctgtatgggat
atttatgagcggcagatttatcaacttctcgaccatgctgtcacttatacagggtgttgg
gttggtgaacaatggaggaattctgttttaggccggtttaactcaggaaaacataatctc
agttattctgagatgcagggaaaagtatataaggacattattggctttttgaaaggtccg
tctaacggagttttagcgcttgatccagacggtgtcagactgttgtccttcagggaaaga
agtatacctttttccccttcattcattactttcattaatgacattgtttccccggatgat
ctgcttgatgtttggctcagagagcgaacgcaaaacaaggatgaattaataaatgtacag
gggcaactagacttactgaatcagaccctacaaaatgctgagtcacagccttacagagtt
acgatagatagtgcacctgcgacaattccggataatccccgagtcaaaccaacaggtaca
actctgactcttgagtgtaaaacaggtaacagcagtatacgaagtatgaattttgctgat
tcaggtatttttacctggtatccgggaagctgtcactctgtaagaattgacattttgttc
cctaatttttctgccacctataagtttacaggagaaacagcctggattgattttatcaac
aagttttcggatggagagagtgagttaatgacaaaggatttttctccagaatcaagaaat
tttctcgaatcaatggggattaaaggcattcttgtccgttacaaactgagtgatacaggc
aatctaagtcaggcatatatcgaatgggaacaactaaaacaggaaaaggataaacttaaa
gatttacaggtgaatctgagtaataagctgcttaccacacatagctgggagaaaagtgcc
tggatttccagactgcccggcaatataacaatatgtccagtagtacaggagtga

DBGET integrated database retrieval system