KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4577
Entry
EC042_4577        CDS       T02067                                 

Definition
(GenBank) putative type VI secretion protein
  KO
K11907  type VI secretion system protein VasG
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EC042_4577
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elo02044]
    EC042_4577
Secretion system [BR:elo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EC042_4577
SSDB
Motif
Pfam: AAA_2 AAA_lid_9 AAA AAA_5 AAA_16 ClpB_D2-small AAA_22 Sigma54_activat AAA_25 IstB_IS21 AAA_7 AAA_30 AAA_18 AAA_29 DUF815 Zeta_toxin TniB NACHT ABC_tran T2SSE AAA_24 AAA_28 RsgA_GTPase Cyclin_N AAA_6 NTPase_1 MeaB CorA
Other DBs
NCBI-ProteinID: CBG37398
UniProt: D3GV04
Position
4908894..4911443
AA seq 849 aa
MSIYLKPIINKLTPESRNTLDSAINYAISRSHHEVDCLHLLWKLLQEHKYIAEVLYEQSL
FNPEWVLNAIESELIRINTVPQSSPVFSESMQTLLEKTWIHASTKWQIDHIDIPVFLSTM
INFRDSIFPLNVSDALCCDMDVAEELLISFSDEAEHSASHRPTDRSSHEYLSKYTENLSL
RAETGKLDPVTGREKEVRQLIDILLRRRQNNPILTGEPGVGKSSIVEGLALQIASGRVPD
VLKNVRIHALDMGALLAGASVRGEFENRLKSLLTELNSLDGTAILFIDEAHSLIGAGGLP
GQTDAANLLKPALARGELRIIAATTWGEYKKYFEKDGALARRFQIVKVAEPNQDVTAEML
RSLLPMMEKHHNVSIREEAITATVHLSDRYLHGRRQPDKSVSLLDTACSRVAVSQSTSPD
AIQDVEASLVRYQGELALLTQERSDVLRQEMLANKIAQLEEELEQLKSAWRHQSELVAKI
QSSDDISSKNMYRKELESAYKKDSPMVFECVDKNCVADVVSGWTGVPLGVCLDGEQQKAS
GLLRCLEQRVLGQRYAMSAIASQVLICRADLKDPVKPDGVFLLAGPSGTGKTETARALAE
FVYGDENKLITINMTEFQEAHTVSTLKGAPPGYVGFGQGGTLTERVSHNPYSVILLDEIE
KAHPDVLEFFFQIFDSGIIEDAEGKMVSFRDCLIIMTSNFASENITNIWNDGETNRDRIK
EMLLPLFNEHFGAAFMGRTNLIPFTPLHSKTLRDIVLIKIDKICQRFEQASGQMYKIEYN
DSLIDWITHHCQCDKSGARDIDSVLNSTVLPVLARYLTDSEDNRTPKKIRISVRKNNITL
RSSQFATRN
NT seq 2550 nt   +upstreamnt  +downstreamnt
gtgagtatctatctgaaaccaattattaataaattaactccagaaagtcgaaatactctg
gattctgcaattaattacgcaatatcaaggtcacatcatgaagtagactgtctacatctt
ctatggaagttattgcaggaacataaatatatagccgaagtgctttatgagcagtcctta
tttaatcctgagtgggttcttaatgctattgaaagtgaacttatccgtatcaatacagta
ccacaatcctcacctgtattttctgagtcgatgcagactctactggagaaaacatggata
catgccagtactaaatggcaaatcgatcatatagatatccctgtctttttgagtactatg
attaatttcagagattcaatatttcctctcaatgtttctgatgcgttatgttgtgatatg
gatgtagctgaggagttacttatctctttttcagacgaagcagagcattctgcttctcat
cgtcccaccgataggtcttcacatgaatatctcagtaaatatactgagaatctctctctg
cgggcagaaacaggtaaattagatccggttactggcagagagaaggaagtcagacaactt
atcgatattttgcttcgtcgcagacagaataatccaatactgaccggtgaaccgggagta
gggaaaagtagtatagtagaaggtttagcactgcaaattgcgtctggccgtgtgcctgat
gtactgaagaatgtccggatccatgcccttgatatgggggctctgcttgcgggagccagt
gtcagaggggaattcgaaaatcgcctaaaatcactgttgaccgaacttaattctttggat
ggcacagctattttgtttattgatgaggctcattcccttatcggtgcaggaggacttccg
ggacagactgatgcagctaatttgcttaagcctgctcttgcccgtggagaattgcgcatt
atagccgcaacgacatggggagaatataaaaagtattttgaaaaggatggggcgttagcc
cggcgttttcagatagtaaaagtagcagagccaaatcaggatgtcacagcggaaatgcta
cgttctcttttgcccatgatggaaaaacaccataatgtttctatcagggaagaagcaata
actgcaacggtacatctatcagaccgttatctgcatgggcgccgtcaaccagataaatct
gtaagtctgttagatacagcttgttctcgggttgctgtatctcagtctacatcaccagat
gccattcaggatgtcgaagcttcattggtaagataccaaggggaacttgcgctgctgaca
caggaaaggtcagatgttttgcgtcaggaaatgcttgcaaataaaattgctcaacttgag
gaggagcttgagcaactcaaatcagcgtggcgtcatcaaagtgaactggttgcaaaaata
caaagttcagatgatatttcatcaaagaatatgtacagaaaagaactggaaagtgcatat
aagaaagacagtcctatggtttttgagtgtgtggataaaaattgtgttgctgatgttgtt
tctgggtggacaggtgttccactgggtgtatgccttgatggtgaacaacaaaaagcatcc
ggtctgttaagatgcttggagcagcgagttttggggcagcgatatgctatgtccgctatt
gcatcacaagttcttatttgtcgggcagatcttaaagatcctgtaaaacctgatggggta
tttttacttgcgggcccttctggcacaggcaaaacggagacagccagggcgctggccgag
tttgtttatggggatgagaataaactcatcacgattaatatgactgaatttcaggaagct
cacactgtttccactctgaagggggcacctcctggatatgttggttttggtcagggaggg
actcttactgaaagggtgagtcataatccatacagtgttattctgcttgatgaaattgaa
aaagcacatccggatgtcctggagttcttcttccagatatttgactcaggtattatcgag
gatgctgaaggtaagatggtgtctttcagagattgtctcataataatgacatcaaacttt
gccagtgaaaatatcacaaacatatggaatgatggtgagacaaatagagacagaataaaa
gaaatgcttcttcctttgtttaatgagcattttggggcggcatttatggggagaactaac
ttaattccgttcacaccgttgcattccaaaacactgagagatatcgtactcattaaaatt
gataagatctgccaacgttttgaacaggcatcaggtcagatgtataagatagaatacaat
gattctcttattgactggattacacatcattgtcaatgtgataagtctggagctagggat
atagactcagtacttaacagcacggttcttcctgtcttggccagatatttgactgactct
gaagataatagaacccccaagaaaataagaatatcagtaaggaaaaataacattacatta
cgtagttcgcaatttgcaactcgtaattga

DBGET integrated database retrieval system