KEGG   Escherichia coli O44 H18 042 (EAEC): EC042_4870Help
Entry
EC042_4870        CDS       T02067                                 

Definition
(GenBank) 5'-nucleotidase (nucleoside 5'-monophosphate phosphohydrolase)
  KO
K08723  5'-nucleotidase [EC:3.1.3.5]
Organism
elo  Escherichia coli O44:H18 042 (EAEC)
Pathway
elo00230  Purine metabolism
elo00240  Pyrimidine metabolism
elo00760  Nicotinate and nicotinamide metabolism
elo01100  Metabolic pathways
elo01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:elo00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    EC042_4870
   00240 Pyrimidine metabolism
    EC042_4870
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    EC042_4870
Enzymes [BR:elo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.5  5'-nucleotidase
     EC042_4870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HAD
Motif
Other DBs
NCBI-ProteinID: CBG37691
UniProt: D3GY13
Position
5209947..5210624
Genome map
AA seq 225 aa AA seqDB search
MKWDWIFFDADETLFTFDSFTGLQRMFLDYSVTFTAEDFQDYQAVNKPLWVDYQNGAITS
LQLQHGRFESWAERLKVEAGLLNDAFINAMAEICTPLPGAVSLLNAIRGNAKIGIITNGF
SALQQVRLERTGLRDYFDLLVISEEVGVAKPNKKIFDYALEQAGNPDRSRVLMVGDTAES
DILGGINAGLATCWLNAHHREQPEGIAPTWTVSSLHELEQLLCKH
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgaagtgggactggattttctttgatgccgatgaaacgctgtttacctttgactcattc
accggcctgcagcggatgtttcttgattacagcgtcacctttaccgctgaagattttcag
gactatcaggccgttaacaagccactgtgggtggattatcaaaacggcgcgatcacttca
ttacagcttcagcacgggcgttttgagagctgggccgaacggctgaaagttgaagcaggc
ttgcttaacgatgcctttattaatgcgatggcggaaatctgcacgccgctgccgggcgcg
gtttctctgcttaacgccattcgtggcaacgccaaaatcggcatcatcaccaacggcttt
agcgccttgcagcaagtgcgtctggaacgcacgggcctgcgtgattacttcgatttgctg
gtgatttccgaagaagttggcgttgccaaaccgaataagaaaattttcgattatgcgctg
gaacaggcgggcaatcctgaccgttcacgcgtgctgatggttggcgacactgccgagtcc
gatattctcggtggcatcaacgccgggcttgcgacctgctggctgaatgcgcaccatcgc
gagcaaccagaaggcatcgcgcccacctggaccgtttcttcgttgcacgaactggagcag
ctcctgtgtaaacactga

DBGET integrated database retrieval system