KEGG   Escherichia coli P12b: P12B_c0433Help
Entry
P12B_c0433        CDS       T02030                                 

Gene name
ispA
Definition
(GenBank) Geranylgeranyl pyrophosphate synthase
  KO
K00795  farnesyl diphosphate synthase [EC:2.5.1.1 2.5.1.10]
Organism
elp  Escherichia coli P12b
Pathway
elp00900  Terpenoid backbone biosynthesis
elp01100  Metabolic pathways
elp01110  Biosynthesis of secondary metabolites
elp01130  Biosynthesis of antibiotics
Module
elp_M00364  C10-C20 isoprenoid biosynthesis, bacteria
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    P12B_c0433 (ispA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:elp01006]
    P12B_c0433 (ispA)
Enzymes [BR:elp01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     P12B_c0433 (ispA)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     P12B_c0433 (ispA)
Prenyltransferases [BR:elp01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   P12B_c0433 (ispA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: polyprenyl_synt UbiA Arm-DNA-bind_3
Motif
Other DBs
NCBI-ProteinID: AFG39315
Structure
PDB: 

Position
complement(460332..461231)
Genome map
AA seq 299 aa AA seqDB search
MDFPQQLEACVKQANQALSRFIAPLPFQNTPVVETMQYGALLGGKRLRPFLVYATGHMFG
VSTNTLDAPAAAVECIHAYSLIHDDLPAMDDDDLRRGLPTCHVKFGEANAILAGDALQTL
AFSILSDADMPEVSDRDRISMISELASASGIAGMCGGQALDLDAEGKHVPLDALERIHRH
KTGALIRAAVRLGALSAGDKGRRALPVLDKYAESIGLAFQVQDDILDVVGDTATLGKRQG
ADQQLGKSTYPALLGLEQARKKARDLIDDARQSLKQLAEQSLDTSALEALADYIIQRNK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggactttccgcagcaactcgaagcctgcgttaagcaggccaaccaggcgctgagccgt
tttatcgccccactgccctttcagaacactcccgtggtcgaaaccatgcagtatggcgca
ttattaggtggtaagcgcctgcgacctttcctggtttatgccaccggtcatatgttcggc
gttagcacaaacacgctggacgcacccgctgccgccgttgagtgtatccacgcttactca
ttaattcatgatgatttaccggcaatggatgatgacgatctgcgtcgcggtttgccaacc
tgccatgtgaagtttggcgaagcaaacgcgattctcgctggcgacgctttacaaacgctg
gcgttctcgattttaagcgatgccgatatgccggaagtgtcggaccgcgacagaatttcg
atgatttctgaactggcgagcgccagtggtattgccggaatgtgcggtggtcaggcatta
gatttagacgcggaaggcaaacacgtacctctggacgcgcttgagcgtattcatcgtcat
aaaaccggcgcattgattcgcgccgccgttcgccttggtgcattaagcgccggagataaa
ggacgtcgtgctctgccggtactcgacaagtatgcagagagcatcggccttgccttccag
gttcaggatgacatcctggatgtggtgggagatactgcaacgttgggaaaacgccagggt
gccgaccagcaacttggtaaaagtacctaccctgcacttctgggtcttgagcaagcccgg
aagaaagcccgggatctgatcgacgatgcccgtcagtcgctgaaacaactggctgaacag
tcactcgatacctcggcactggaagcgctagcggactacatcatccagcgtaataaataa

DBGET integrated database retrieval system