KEGG   Escherichia coli P12b: P12B_c2964
Entry
P12B_c2964        CDS       T02030                                 

Gene name
xdhA
Definition
(GenBank) Aerobic-type carbon monoxide dehydrogenase, la rge subunit CoxL/CutL-like protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
elp  Escherichia coli P12b
Pathway
elp00230  Purine metabolism
elp01100  Metabolic pathways
elp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P12B_c2964 (xdhA)
Enzymes [BR:elp01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     P12B_c2964 (xdhA)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: AFG41800
Position
3233128..3235425
AA seq 765 aa
MEAREATATGESCMRVDAIAKVTGRARYTDDYVMAGMCYAKYVRSPIAHGYAVSINDEQA
RSLPGVLAIFTWEDVPDIPFATAGHAWTLDENKRDTADRALLTRHVRHHGDAVAIVVARD
ELTAEKAAQLVSIEWQELPVITTPEAALAEDAAPIHNGGNLLKQSTMSTGNVQQTIDAAD
YQVQGHYQTPVIQHCHMESVTSLAWMEDDSRITIVSSTQIPHIVRRVVGQALDIPWSCVR
VIKPFVGGGFGNKQDVLEEPMAAFLTSKLGGIPVKVSLSREECFLATRTRHAFTIDGQMG
VNRDGTLKGYSLDVLSNTGAYASHGHSIASAGGNKVAYLYPRCAYAYSSKTCYTNLPSAG
AMRGYGAPQVVFAVESMLDDAATALGIDPVEIRLRNAAREGDANPLTGKRIYSAGLPECL
EKGRKIFEWEKRRAECQNQQGNLRRGVGVACFSYTSNTWPVGVEIAGARLLMNQDGTINV
QSGATEIGQGADTVFSQMVAETVGVPVSDVRVISTQDTDVTPFDPGAFASRQSYVAAPAL
RSAALLLKEKIIAHAAVMLHQSAMNLTLIKGHIVLVERPEEPLMSLKDLAMDAFYHPERG
GQLSAESSIKTTTNPPAFGCTFVDLTVDIALCKVTINRILNVHDSGHILNPLLAEGQVHG
GMGMGIGWALFEEMIIDAKSGVVRNPNLLDYKMPTMPDLPQLESAFVEINEPQSAYGHKS
LGEPPIIPVAAAIRNAVKMATGVAINTLPLTPKRLYEEFHLAGLI
NT seq 2298 nt   +upstreamnt  +downstreamnt
atggaagcgcgggaagcaaccgctacgggtgaatcatgcatgcgcgtcgatgccattgct
aaggtcaccgggcgggcacgatatactgacgattatgttatggcgggcatgtgttatgcg
aaatatgtacgtagccctatcgcacatggttatgccgtaagtattaatgatgaacaagcc
agaagtttgccgggcgtactggcgatttttacctgggaagatgtgcctgatattccattc
gctacagctgggcatgcctggacacttgacgaaaacaagcgcgataccgccgatcgcgca
ctgctaactcgccatgttcgtcatcatggtgacgccgttgccatcgtcgtggcccgcgat
gaactcacggcagaaaaagcggcgcaattggtcagcattgagtggcaagaattacccgtt
atcaccacgccagaagcggcgctggcagaagacgctgcaccaatccataacggtggcaat
ttactgaaacaaagcacgatgtcgacgggtaatgtccaacaaacaatcgatgccgccgac
taccaggtacaggggcactatcagacccccgttattcaacattgtcacatggaaagcgta
acatcgctggcgtggatggaggatgactcgcgaattaccatcgtttccagcacccagatc
ccgcacattgttcgccgcgtggttggtcaggcgctggatattccctggtcatgcgtacga
gtcatcaaaccatttgtcggtggcggttttggtaataaacaggatgtactggaagagcca
atggcggcattcctgaccagcaagcttggcggcattccggtgaaagtttcccttagccgt
gaagagtgtttcctcgcaacccgtacccgccacgcttttaccattgacgggcaaatgggc
gtgaaccgcgacggaacattgaaaggttatagtctggatgttctgtctaacaccggcgct
tatgcatctcacgggcactccatcgcttctgcgggggggaataaagtcgcttacctttat
cctcgttgtgcctacgcttacagttcaaagacctgctataccaacctcccctcggctggt
gcgatgcgtggttatggcgcgccacaagtcgtatttgccgttgagtctatgcttgatgac
gccgcgacagcgttaggtattgatcctgttgaaattcgtttacgcaacgccgcccgcgaa
ggagatgctaatccgctcacgggcaaacgtatttacagcgcagggttgccggagtgtctt
gaaaaaggccggaaaatctttgaatgggaaaaacgccgtgcagaatgccagaaccagcaa
ggcaatttgcgccgcggcgttggcgtcgcctgttttagctacacctctaacacctggcct
gtcggcgtagaaatagcaggcgcgcgccttctgatgaatcaggatggaaccatcaacgtg
caaagcggcgcgacggaaatcggtcagggtgccgacaccgtcttctcgcaaatggtggca
gaaaccgtgggggttccggtcagcgacgttcgcgttatttcaactcaagataccgacgtt
acgccgttcgatcccggcgcatttgcctcacgccagagctatgttgccgcgcctgcgctg
cgcagtgcggcactattattaaaagagaaaatcatcgctcacgccgcagtcatgctacat
cagtcagcgatgaatctgaccctgataaaaggccatatcgtgctggttgaacgaccggaa
gagccgttaatgtcgttaaaagatttggcgatggacgctttctaccaccctgaacgcggc
gggcagctctctgctgaaagctccatcaaaaccaccactaacccaccggcgtttggctgt
acctttgttgatctgacggtcgatattgcgctgtgcaaagtcaccatcaaccgcatcctc
aacgttcatgattcagggcatattcttaatccactgctggcagaaggtcaggtacacggc
ggaatgggaatgggcattggctgggcgctatttgaagagatgatcatcgatgctaaaagc
ggcgtggtccgtaaccccaatctgctggattacaaaatgccgaccatgccggatctgcca
caactggaaagcgcgttcgtcgaaatcaatgagccgcaatccgcatacggacataagtca
ctgggtgagccaccaataattcctgttgccgctgctattcgtaacgcggtgaagatggct
accggtgttgcaatcaatacactgccgctgacgccaaaacggttatatgaagagttccat
ctggcaggattgatttga

DBGET integrated database retrieval system