KEGG   Escherichia coli P12b: P12B_c2966
Entry
P12B_c2966        CDS       T02030                                 

Gene name
xdhC
Definition
(GenBank) Xanthine dehydrogenase iron-sulfur-binding subunit
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
elp  Escherichia coli P12b
Pathway
elp00230  Purine metabolism
elp01100  Metabolic pathways
elp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:elp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    P12B_c2966 (xdhC)
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: AFG41802
Position
3236311..3236790
AA seq 159 aa
MNHSETITIECTINGMPFQLHAAPGTPLSELLREQGLLSVKQGCCVGECGACTVLVDGTA
IDSCLYLAAWAEGKEIRTLEGEAKGGKLSHVQQAYAKSGAVQCGFCTPGLIMATTAMLAK
PREKPLTITEIRRGLAGNLCRCTGYQMIVNTVLDCEKTK
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatcacagcgaaacaattaccatcgaatgcaccattaacgggatgccttttcagctt
cacgccgcaccaggcacgccgctctcggaattactccgcgaacaaggactgctaagtgtc
aaacaagggtgctgcgtgggtgaatgtggtgcctgtacggtgttggtcgacggcacagca
atagacagttgcttataccttgccgcctgggctgaaggaaaagagatccgcacgctggaa
ggtgaagcgaaaggcggaaaactttctcatgttcagcaggcttatgcgaaatccggcgca
gtgcagtgcgggttttgtacgcctggcctgattatggctaccacggcaatgctggcgaaa
ccacgcgagaagccattaaccattacggaaattcgtcgcggactggcgggaaatctttgt
cgctgcacggggtatcagatgattgtaaatacagttctggattgcgagaaaacgaagtaa

DBGET integrated database retrieval system