KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_111463Help
Entry
Ga0102493_111463  CDS       T04740                                 

Definition
(GenBank) phosphopantothenoylcysteine decarboxylase / phosphopantothenate--cysteine ligase
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00770  Pantothenate and CoA biosynthesis
elq01100  Metabolic pathways
Module
elq_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    Ga0102493_111463
Enzymes [BR:elq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     Ga0102493_111463
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     Ga0102493_111463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein PALP
Motif
Other DBs
NCBI-ProteinID: AOL22491
UniProt: A0A074MFQ3
Position
546836..548497
Genome map
AA seq 553 aa AA seqDB search
MCGAGPKILLVVGGGIAAYKSLELVRLIRKGGGDVTCVVTKGGQQFVTPMSLAALSENQV
YTSLFDLKNEVEMGHIQLSREADLVVVCPATADLVAKMASGIADDLATTLILATDKPVMA
VPAMNVRMWEHEATQRNIEWLRQAGVSVLHPDEGAMACGEFGYGRLPEPEVIWREIAAHF
GIEVEDPTPAPAAAPAAANDLVEADDDDEDEDGDVGRGLGGLLSRLIPRSTPKRTHEDIE
TEYSEFEDDFEQDIGEDEGSGGDGLPPEEEIPEFKPDFGGPLLAKKGGASSAPPIDPDAL
NHEFDPRRQPPERLEPGPFESADGDAASFEVDASYRPLKGRHVLVTAGPTWEAIDPVRYI
ANRSSGKQGFAIAAAAAALGAKVTLVAGPVSLRTPEGVTRVDVESAEDMAKAVKRALPAD
AAVMVAAVADWRPKEYRGEKIKKRGSAPPALMLTENPDILTNLAAGKDRPELVIGFAAET
DDVLANAKQKRKRKAADWIVANDVSGDVMGGDDNLVHIVSESGVETLDQMPKRDVAMALA
ERIAATLKAEAAE
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcgctgggccgaaaatcctgctggtcgtgggcggcggtatcgcggcctacaag
tcgttggagctcgtccgcctgatccgcaagggcggcggcgatgtcacctgcgtcgtcacc
aagggcgggcagcaattcgtgacgcccatgtcgcttgcagccctgtcggaaaaccaggtc
tataccagcctgttcgatctcaagaacgaggtcgagatgggccatatccagttgtcgcgc
gaggccgatctcgtcgtcgtctgtcccgccaccgccgatctcgtcgccaagatggcgagc
ggcatcgccgacgatcttgccaccacgctgatcctcgccacggacaagccggtgatggcc
gtccctgcgatgaacgttcggatgtgggaacacgaagcgacccagcgcaacatcgaatgg
ctgaggcaggcgggcgtcagcgtgctccatcccgatgaaggtgcgatggcctgcggcgaa
ttcggctatgggcgcctgcccgaacccgaagtcatctggcgcgagattgcggcgcatttc
gggatcgaggtcgaggatcctacgcccgctccggctgccgctcccgccgccgccaacgat
ctggtcgaagccgacgacgacgacgaggacgaggacggcgatgtcgggcgcgggctcggc
gggctcctgtcgcggctcattccgcgctccacgcccaagcgcacgcacgaggatatcgag
accgaatattccgagttcgaggacgatttcgagcaggatatcggcgaggatgaaggctcc
ggtggcgacggattgccgcccgaggaggaaattcccgaattcaagcctgatttcggcggg
ccgctgctcgcgaagaagggcggggcatcttccgcgccgccgatcgatcccgatgcgctg
aaccacgaattcgacccgcgcaggcagccgcccgaacgccttgaacccgggccgttcgaa
agcgccgacggcgatgcggccagtttcgaagtcgacgcatcctaccgtcccctcaagggc
cgccacgtgctcgtcacagcagggccgacatgggaagcgatcgacccggtgcgctacatc
gccaaccggtcgagcgggaagcagggctttgccatcgccgcggccgctgcggctctcggc
gcgaaagtgacgctggtggcgggcccagtctcgctccgcacgcccgagggtgtgacacgc
gtcgatgtcgaatccgccgaggacatggcgaaagccgtgaaaagggcgcttcccgccgat
gccgctgtcatggtcgcagcggtcgccgactggcggccgaaggaatatcggggcgagaag
atcaagaagcgcggctcggcaccgcccgcgctgatgctgactgaaaatcccgacatcctg
accaatctcgccgccggcaaggatcgcccggaactggtcatcggcttcgctgccgaaacc
gacgatgtcctcgccaatgccaagcagaagcgcaagcgcaaggccgccgactggatcgtc
gccaatgacgtgtcaggagacgtgatgggcggcgacgacaatctcgtccatatcgtgagc
gaaagcggggtcgagacgctcgaccagatgcccaagcgcgacgtcgcgatggcgctggcc
gaacggatcgccgcgacgctcaaggccgaagccgccgaatga

DBGET integrated database retrieval system