KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_112003Help
Entry
Ga0102493_112003  CDS       T04740                                 

Gene name
ndk
Definition
(GenBank) nucleoside-diphosphate kinase
  KO
K00940  nucleoside-diphosphate kinase [EC:2.7.4.6]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00230  Purine metabolism
elq00240  Pyrimidine metabolism
elq01100  Metabolic pathways
elq01110  Biosynthesis of secondary metabolites
elq01130  Biosynthesis of antibiotics
Module
elq_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
elq_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
elq_M00052  Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Ga0102493_112003 (ndk)
   00240 Pyrimidine metabolism
    Ga0102493_112003 (ndk)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:elq04131]
    Ga0102493_112003 (ndk)
Enzymes [BR:elq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.6  nucleoside-diphosphate kinase
     Ga0102493_112003 (ndk)
Membrane trafficking [BR:elq04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    Ga0102493_112003 (ndk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NDK
Motif
Other DBs
NCBI-ProteinID: AOL23022
UniProt: A0A074N597
Position
1125133..1125555
Genome map
AA seq 140 aa AA seqDB search
MAVTRTFSIIKPDATKRNLTGAVTKMLEDAGLRVVASKRIRMSREQAEGFYAVHKERPFF
GELVEFMMSDPVVVQVLEGEDAVKRNRDVMGATNPAEAADGTIRKEYALSIGENTVHGSD
SEENAKIEIEFFFSEDEIVG
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggcggtcacccgcaccttttcgatcatcaagcccgatgcgaccaagcgcaacctgacc
ggcgcggtcaccaagatgctggaagacgccggccttcgcgtcgtcgcctccaagcgcatc
cgcatgtcgcgcgagcaggccgaaggtttctatgcggtccacaaggaacgccccttcttc
ggcgaactggtcgaattcatgatgagcgatccggttgtcgtgcaggttctcgaaggcgag
gatgcggtcaagcgcaaccgcgacgtgatgggtgctaccaatccggcagaagctgccgac
ggcacgatccgcaaggaatatgcgctttcgatcggtgagaacacggtccatgggtcggac
agcgaagagaacgcgaagatcgagatcgaattcttcttcagcgaagacgagattgtcggc
tga

DBGET integrated database retrieval system