KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_112154Help
Entry
Ga0102493_112154  CDS       T04740                                 

Gene name
rplV
Definition
(GenBank) large subunit ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq03010  Ribosome
Brite
KEGG Orthology (KO) [BR:elq00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    Ga0102493_112154 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:elq03011]
    Ga0102493_112154 (rplV)
Ribosome [BR:elq03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    Ga0102493_112154 (rplV)
  Bacteria
    Ga0102493_112154 (rplV)
  Archaea
    Ga0102493_112154 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22 Ribosomal_S13_N SLT_L
Motif
Other DBs
NCBI-ProteinID: AOL23171
UniProt: A0A074MLE9
Position
1265662..1266039
Genome map
AA seq 125 aa AA seqDB search
MGKAKAPRRVGDNEALAVGTTIRGSAQKLNLVAELIRGKKAEEALNILEFSKKGMAKDAK
KVLASAIANAENNHNLDVDALVVAEASVGKSITMKRFHTRGRGKSTRILKPFSRLRIVVR
EQEEA
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgggcaaggcaaaggcaccccgccgcgtcggcgataacgaggcgctggccgtcggcacc
acgatccgtgggtcggcgcagaagctcaatctcgtcgccgaactgatccgcggcaagaag
gccgaagaggctctcaacatcctcgaattctccaagaaggggatggcgaaggacgcgaag
aaggtgctcgcctcggcgatcgccaacgcggagaacaaccacaatctcgacgtcgacgcg
ctcgtcgtggcggaagcctcggtcggcaagtcgatcaccatgaagcggttccacacgcgc
ggccgcggcaagtcgacccggatcctgaagccgttcagccggcttcggatcgtcgtgcgc
gaacaggaagaggcgtaa

DBGET integrated database retrieval system