KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_112353Help
Entry
Ga0102493_112353  CDS       T04740                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00480  Glutathione metabolism
elq00590  Arachidonic acid metabolism
elq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Ga0102493_112353
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Ga0102493_112353
Enzymes [BR:elq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Ga0102493_112353
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-ProteinID: AOL23368
UniProt: A0A074N3F7
Position
1461428..1461907
Genome map
AA seq 159 aa AA seqDB search
MTTIADFTVTTNRGEPLDLASKKGKVLLVVNTASKCGFTPQYDGLEAIYQQFRERDFEVL
AFPCNQFGAQEPGSADEIAEFCRVNFGVSFPLMAKVDVNGPDASPLFDWMKKEAKGLMGS
TSIKWNFTKFLIDRDGKVVKRYGPQDKPEAIAKDIEKLL
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccatcgccgatttcaccgtcaccaccaatcgcggcgaaccgctcgaccttgcc
agcaagaagggcaaggtcctgctcgtcgtcaacacggcgtcgaaatgcggcttcaccccg
caatatgacgggctcgaggcgatctaccagcagttcagggaacgcgatttcgaagtcctc
gcctttccctgcaaccagttcggcgcgcaggagcccggcagcgccgacgaaatcgcggaa
ttctgccgggtcaatttcggcgtctcctttccgctgatggcgaaagtggacgtgaacggc
cccgatgcctcgcccctgttcgactggatgaagaaagaggcaaagggcctgatgggctct
acctcgatcaagtggaacttcaccaagttcctgatcgaccgcgatggcaaggtggtgaag
cgctacggcccgcaggacaagcccgaggccatcgccaaggacatcgagaagctgctgtga

DBGET integrated database retrieval system