KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_11276Help
Entry
Ga0102493_11276   CDS       T04740                                 

Definition
(GenBank) aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00970  Aminoacyl-tRNA biosynthesis
elq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elq00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Ga0102493_11276
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:elq03029]
    Ga0102493_11276
Enzymes [BR:elq01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Ga0102493_11276
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Ga0102493_11276
Mitochondrial biogenesis [BR:elq03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Ga0102493_11276
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: AOL24419
UniProt: A0A074MEQ0
Position
complement(2562651..2564132)
Genome map
AA seq 493 aa AA seqDB search
MTDLTQLGIKAIRDGVRVGEFTAREVAEAFNAAVAEAAELNAFIVTTPGHALAAADEVDQ
ARAAGDELGAMAGVPIGMKDLFATRGVQTSAASHILEGFRPEYESTVSQNLWKAGAGMLG
KLNLDQFAMGSSNETSHFSNVASPWRKAGSNQPMSPGGSSGGSSSAVAARIAPAATGTDT
GGSIRQPAAFTGICGIKPTYGRCSRWGVVAFASSLDQAGPMARSVEDCAIMLGAMAGFDS
KDATSLDMPVPDWGGALSSDLRGKKIGIPEEYRREGTDQAILDAWEQGKAWLKDAGAEIV
DVSLPHTKYALPAYYIIAPAEASSNLARYDGVRYGLRELPEGAGLQDMYAETREAGFGDE
VKRRILIGTYVLSAGFYDAYYNQAQKVRALVARDFERAFGEVDLILAPTTPTASFPLGSM
NEDPLTMYLNDVFAVPASLAGLPAMSVPAGLNPDGLPLGLQLVGKPFDEQSVLDAGLAIE
QRAGFTAAPEKWW
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctcactcaactgggtatcaaggcgatccgcgacggcgtgcgcgtcggagaa
ttcaccgcgcgcgaagtggcggaagccttcaacgcagcggtcgccgaggcggccgaattg
aacgccttcatcgtcaccacccccggacacgcgctcgccgcggcggacgaggtcgaccag
gcgcgcgccgccggggacgagctcggcgcgatggcgggcgtgccgatcgggatgaaggac
ctgttcgccacgcgcggcgtccagaccagcgcggcgagccacatcctcgaaggcttcagg
cccgagtatgaaagcaccgtcagccagaacctctggaaggcgggcgcgggaatgctcggc
aagctcaatctcgatcagttcgcgatgggttcgtcgaacgagaccagccatttcagcaat
gtcgcctcgccgtggcgcaaggcgggctcgaaccagccgatgagcccgggcggctcgtcg
ggcgggtcctccagcgcagtcgccgcgcggatcgcgccggctgcgaccgggaccgacacc
ggcggctcgatccggcaaccggccgccttcaccggcatctgcggaatcaagccgacctat
ggccgctgctcgcgctggggcgtggtcgccttcgcctcctcgctcgaccaggccgggccg
atggcaaggtctgtggaggattgcgcgatcatgctgggcgcaatggccggtttcgattcg
aaggacgcgacgagcctcgacatgccggtgcccgactggggaggcgcgctctccagcgac
ctgcgcggcaagaagatcggcatccccgaggaatatcgccgcgaggggaccgatcaggcg
atcctcgatgcatgggagcagggcaaggcatggctcaaggacgcgggggccgagatcgtc
gatgtctcgctgccgcacacgaaatacgcgctgcccgcctattacatcatcgcgccagcc
gaagcctcttcgaacctcgcgcgctatgacggcgtgcgctacggcctgcgcgaactgccg
gaaggcgcggggctgcaggatatgtacgccgaaacgcgtgaggccggcttcggcgacgag
gtcaagcggcgcattttgatcgggacctatgtgctctcggctggcttctacgatgcctat
tacaaccaggcgcagaaggtccgtgcgctggtcgcccgcgatttcgagcgcgcctttggc
gaagtcgacctgatcctcgcgccgacgacgcccacggcaagctttccgctgggttcgatg
aacgaagacccgctgacgatgtatctgaacgacgtcttcgcggtccccgcctcgcttgcc
gggcttccggcgatgagcgtgcccgccgggctcaaccccgatggcctgccgctggggctg
cagctggtgggcaagcctttcgacgagcagagtgtgctcgatgcggggctcgcgatcgaa
cagcgggcgggctttactgcagcgccggagaaatggtggtga

DBGET integrated database retrieval system