KEGG   Erythrobacter litoralis DSM 8509: Ga0102493_11761Help
Entry
Ga0102493_11761   CDS       T04740                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
elq  Erythrobacter litoralis DSM 8509
Pathway
elq00071  Fatty acid degradation
elq00072  Synthesis and degradation of ketone bodies
elq00280  Valine, leucine and isoleucine degradation
elq00310  Lysine degradation
elq00362  Benzoate degradation
elq00380  Tryptophan metabolism
elq00620  Pyruvate metabolism
elq00630  Glyoxylate and dicarboxylate metabolism
elq00640  Propanoate metabolism
elq00650  Butanoate metabolism
elq00900  Terpenoid backbone biosynthesis
elq01100  Metabolic pathways
elq01110  Biosynthesis of secondary metabolites
elq01120  Microbial metabolism in diverse environments
elq01130  Biosynthesis of antibiotics
elq01200  Carbon metabolism
elq01212  Fatty acid metabolism
elq02020  Two-component system
Brite
KEGG Orthology (KO) [BR:elq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Ga0102493_11761
   00630 Glyoxylate and dicarboxylate metabolism
    Ga0102493_11761
   00640 Propanoate metabolism
    Ga0102493_11761
   00650 Butanoate metabolism
    Ga0102493_11761
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Ga0102493_11761
   00072 Synthesis and degradation of ketone bodies
    Ga0102493_11761
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Ga0102493_11761
   00310 Lysine degradation
    Ga0102493_11761
   00380 Tryptophan metabolism
    Ga0102493_11761
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Ga0102493_11761
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Ga0102493_11761
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Ga0102493_11761
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:elq04147]
    Ga0102493_11761
Enzymes [BR:elq01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Ga0102493_11761
Exosome [BR:elq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Ga0102493_11761
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III PTA_PTB
Motif
Other DBs
NCBI-ProteinID: AOL24890
UniProt: A0A074MUC4
Position
3081093..3082319
Genome map
AA seq 408 aa AA seqDB search
MTRRAAICTPLRTPVGKFLGGLSSMDAGQLGAVILKALVERSGIDPARVDDVVFSQGYGN
GEAPAIGHWSWLAADLPLEVPGFQLDRRCGSGVQAIATAAMMVETGMADMVVAGGVESMS
NVEHYTLQGRGGARMGDITLHDRLSRGRVRSQPIERFGVISGMIETAENLAKDYGITREQ
ADAYAVRSHLNAARAWDEGRFDAQLVPVDVPQRKGDPVLFAKDEGFRPDASMETLGALRA
IDGRRDAQAIVTAGNASQQNDAAAACLVVAEDKLEELGLEPMLWFGGWAAAGCDPSRMGI
GPVPAVERLFARRGYSWADIGLVELNEAFAPQVLAVLKGWGWSEDDSRREILNVNGSGIS
LGHPIGATGGRILADMAHEMKRRDVRYGLETMCIGGGQGIAAVFENAQ
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaccagaagagccgccatctgcaccccgctccgcacccccgtgggcaagttcctcggc
ggattgtcgagcatggacgcgggccaactgggcgctgtgatcctcaaggcattggtcgag
cgttcgggcatcgatcccgcgcgggtcgacgatgtcgtcttctcgcagggctacggcaat
ggcgaggccccggcgatcgggcactggtcgtggctcgccgccgatctcccgctcgaagtg
ccgggcttccagctcgatagacgctgcgggtcgggcgttcaggcgatcgcgaccgcggcg
atgatggtcgagaccggcatggccgacatggtcgtcgcgggcggcgtcgaatccatgtcc
aatgtcgagcattacaccctgcagggccgcggcggggcgcggatgggcgacatcacgctg
catgaccggctgtcgcgcgggcgggtgcgcagccagccgatcgaacgcttcggcgtcatc
agcggaatgatcgagaccgccgaaaacctcgccaaggattacggcatcacccgcgaacag
gccgacgcatacgccgtgcgctcgcacctgaacgcggcgagggcgtgggacgagggccgg
ttcgacgcacaactggtcccggtggacgtgccgcagcgcaagggcgatccggtgcttttc
gcaaaggacgagggcttccgccccgatgcctcgatggagacgctgggcgccctgcgcgcc
atcgacggcaggcgcgacgcacaagcgatcgtgacggcgggcaatgccagccagcagaac
gacgcggccgcagcctgcctcgtcgtcgcggaggacaagctcgaggaactcggcctcgaa
cccatgctgtggttcggcggctgggcagcggcgggctgcgatccttcgcgcatggggatc
ggccctgtcccggcggtcgagcgccttttcgcgcgccggggctacagctgggccgatatc
ggccttgtcgagctcaacgaagccttcgctccgcaggtgctcgccgtgctcaagggctgg
ggctggagcgaggacgacagccgccgcgagatcctcaatgtcaatggctcgggcatcagc
ctcggccacccgatcggcgcgaccggcgggcgcatccttgcagacatggcgcacgagatg
aagcgccgggatgtgcgctatgggcttgagaccatgtgcatcggcgggggtcagggcatc
gccgcggtgttcgagaacgcccaatga

DBGET integrated database retrieval system