KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_01095
Entry
ECO55CA74_01095   CDS       T02066                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:elr00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    ECO55CA74_01095
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elr02044]
    ECO55CA74_01095
Secretion system [BR:elr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO55CA74_01095
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: AEZ38851
Position
complement(255927..256451)
AA seq 174 aa
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLQAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPI
KLDEKTQFIGVVAYFSDDQTTEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagcgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgactgaaccggacaccaataccaatgcg
gagggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
caggcagccgactatgaccagatagccagtacgccgctaccggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccgata
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccagacc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system