KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_01120Help
Entry
ECO55CA74_01120   CDS       T02066                                 

Definition
(GenBank) hypothetical protein
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AEZ38856
Position
complement(261072..261620)
Genome map
AA seq 182 aa AA seqDB search
MKDLPVHLFETMGQIQAKIPTEVLVTDRREFELAEEGFITLTMRKDSDNAAFFSANSVQK
PKHFPGKDAETNYKLGTQLPYLFIINRLAHYIKVLQREQLGSWKERSDLERELNTWIRQY
VADQENPPADVRSRKPLRAAKVEVMDVEGEPGWYQVALSVRPHFKFMGANFELSLVGRLD
RE
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
gtgaaagatctgccggtgcatctgttcgaaacgatggggcagattcaggccaaaatccca
accgaggtgctggtcaccgatcgccgcgaatttgaactggctgaagagggttttatcacc
cttaccatgcgtaaagactctgataatgcagcctttttctctgcaaactcggtacaaaaa
ccgaagcactttccgggaaaagatgcagaaaccaactataagctgggtacgcagcttcct
tatctcttcatcatcaatcggttagcgcactacatcaaggtgttgcagcgtgaacaactg
gggtcatggaaagaaaggagcgacttagaaagagagcttaatacctggatccgtcagtat
gttgccgaccaggaaaacccgcctgcagacgtgcgcagccgcaaacctctgcgcgctgcc
aaagttgaggttatggatgtagaaggcgaacccggctggtaccaggttgcgctaagcgtg
agacctcattttaaatttatgggggcaaattttgagctttccctggttggccggttagac
agggagtaa

DBGET integrated database retrieval system