KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_01135
Entry
ECO55CA74_01135   CDS       T02066                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elr02044]
    ECO55CA74_01135
Secretion system [BR:elr02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   ECO55CA74_01135
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AEZ38859
Position
complement(262857..263357)
AA seq 166 aa
MSKKFEGSVAPRERINISYVPKTDGQTAEVELPLNMLVVGDTGNTQETSSLDERQAVSVN
KHNFGAVMAEAAIGLNFTVPATLKGSTTDDELNVALNIKSLDDFSPDSVARQVPEVNKLL
ELREALTALKGPMGNLPAFRTQLQALLENEESREQLLKEIGQVSNK
NT seq 501 nt   +upstreamnt  +downstreamnt
atgagcaaaaaatttgaaggcagcgtcgcgcctcgcgaacgtattaatatatcgtatgtc
ccaaaaacagatggccagacggctgaagtggaacttccgcttaacatgctcgttgtcggc
gataccggaaatacgcaggaaacatcctcactggatgaacgtcaggcagtttccgttaac
aagcacaatttcggtgcagtgatggctgaagcagccattggcctcaattttaccgtcccc
gccacgctgaagggaagcacaacggacgatgaactgaatgtggcgctgaatatcaagtca
ctggatgatttttcaccagatagcgtggcccggcaggttccggaagtgaataaattgctg
gaactgcgtgaagcactgactgcactgaaggggccgatgggtaaccttccggcattccgt
acccagctccaggcattgctggaaaatgaagagtcccgcgagcagttgctcaaagaaatc
ggccaggtgagcaataaataa

DBGET integrated database retrieval system