KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_07785Help
Entry
ECO55CA74_07785   CDS       T02066                                 

Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00260  Glycine, serine and threonine metabolism
elr00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01130  Biosynthesis of antibiotics
elr01230  Biosynthesis of amino acids
Module
elr_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ECO55CA74_07785
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    ECO55CA74_07785
Enzymes [BR:elr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     ECO55CA74_07785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AEZ40153
Structure
PDB: 

Position
complement(1622496..1623689)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETNVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacggctggcacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaaccgaaatcatcgccgaaaccggggccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgtatttatatgggggccaaagacgttgaa
cgccagtcgcctaacgtttttcgtatgcgtttaatgggtgcggaagtgatcccggtgcat
agcggttccgcgacgctgaaagatgcctgtaacgaggcgctgcgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggcaccgcagctggcccacatccttatccgaccatt
gtccgtgagtttcagcggatgattggcgaagaaaccaaagcacagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggcggttcgaatgccatcggcatg
tttgcagatttcatcaacgaaaccaacgtcggcctgattggtgtggagcctggtggtcac
ggtatcgaaactggcgagcacggcgcaccgctaaaacatggtcgcgtgggtatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcagattgaagaatcttactccatc
tccgccggactcgattttccgtccgtcggcccacaacacgcgtatcttaacagcactgga
cgcgctgattatgtgtcaattaccgatgatgaagcactggaagccttcaaaacgctgtgc
ctgcacgaagggattatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaacccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system