KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_09010Help
Entry
ECO55CA74_09010   CDS       T02066                                 

Definition
(GenBank) ethanol-active dehydrogenase/acetaldehyde-active reductase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00010  Glycolysis / Gluconeogenesis
elr00071  Fatty acid degradation
elr00350  Tyrosine metabolism
elr00625  Chloroalkane and chloroalkene degradation
elr00626  Naphthalene degradation
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01120  Microbial metabolism in diverse environments
elr01130  Biosynthesis of antibiotics
elr01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO55CA74_09010
  Lipid metabolism
   00071 Fatty acid degradation
    ECO55CA74_09010
  Amino acid metabolism
   00350 Tyrosine metabolism
    ECO55CA74_09010
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    ECO55CA74_09010
   00626 Naphthalene degradation
    ECO55CA74_09010
Enzymes [BR:elr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     ECO55CA74_09010
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C Methyltransf_31 Phage_holin_2_1
Motif
Other DBs
NCBI-ProteinID: AEZ40390
Structure
PDB: 

Position
complement(1872893..1873903)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTKDHHVDVTDKTLRSLKHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVTSLKPGDRASVAWFYEGCGHCEYCNSGNETLCRSVKNAGYSVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKLSKIRPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLATEMGADLAINSRTEDAAKIVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPESMSLDIPRLVLDGIEVVSSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLADINTIFTEMEEGKIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgcagttgttacgaaggatcatcatgttgacgttacggataaaacactgcgc
tcactgaaacatggcgaagccctgctgaaaatggagtgttgtggtgtatgtcataccgat
cttcatgttaagaatggcgattttggtgacaaaaccggcgtaattctgggccatgaaggg
attggtgtggtggcagaagtgggtccaggtgtcacctcattaaaaccaggcgatcgtgcc
agcgtggcgtggttctacgaaggatgcggtcattgcgaatactgtaacagtggtaacgaa
acgctctgccgttcagttaaaaatgccggatacagcgttgatggcgggatggcggaagag
tgcatcgtggtcgccgattacgcggtaaaagtgccagatggtctggactcggcggcggcc
agcagcattacctgtgcgggggtcaccacctacaaagccgttaagctgtcaaaaattcgt
cccgggcagtggattgctatctacggtcttggcggtctgggtaacctcgccctgcaatac
gcgaagaatgtctttaacgcgaaagtgatcgccattgatgtcaatgatgagcagttaaaa
ctggcaaccgaaatgggtgcagatttagcgattaactcacgcaccgaagacgccgccaaa
attgtgcaggagaaaaccggtggcgctcacgctgcggtggtaacagcagtagctaaagct
gcgtttaactcggcagttgatgctgtccgtgcaggcggtcgtgttgtggctgtcggtctg
ccgccggagtctatgagcctggatatcccacgtcttgtgctggatggcattgaggtggtc
agttcgctggtcggcacgcgccaggatctaactgaagccttccagtttgccgccgaaggt
aaagtggtgccgaaagtcgccctgcgtccgttagcggacatcaacaccatctttaccgag
atggaagaaggcaaaatccgtggccgtatggtgattgatttccgccgctaa

DBGET integrated database retrieval system