KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_10705Help
Entry
ECO55CA74_10705   CDS       T02066                                 

Definition
(GenBank) aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00010  Glycolysis / Gluconeogenesis
elr01100  Metabolic pathways
elr01110  Biosynthesis of secondary metabolites
elr01120  Microbial metabolism in diverse environments
elr01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:elr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ECO55CA74_10705
Enzymes [BR:elr01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ECO55CA74_10705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEZ40727
Position
2215297..2216181
Genome map
AA seq 294 aa AA seqDB search
MIKKIFALPVIEQISPVLSRRKLDELDLIVVDHPQVKASFALQGAHLLSWKPAGEEEVLW
LSNNTPFKNGVAIRGGVPVCWPWFGPAAQQGLPAHGFARNLPWTLKSHREDANGVALTFE
LTQSEETKKFWLHDFTLLAHFRVDKNCEIDLEAHGEFETTSALHTYFNVGDIAKVSVSGL
GDRFIDKVNDAKEDVLTDGIQTFPDRTDRVYLNPQDCSVINDEALNRIIAVGHQHHLNVV
GWNPGPALSVSMGDMPDDGYKTFVCVETAYASEMQKVTKEKPAHLAQSIRVAKR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaagaaaatttttgcccttccggtcatcgaacaaatctcccctgtcctctcccgt
cgtaaactggatgaactggacctcattgtagtcgatcatccccaggtaaaagcctctttt
gcattacagggcgcacaccttctctcgtggaaacctgcaggtgaagaagaagttctgtgg
ttgagcaacaacacaccgttcaaaaatggcgttgctattcgcggtggcgtaccggtttgc
tggccgtggtttggtccggcggcacaacaaggcctgcctgcgcacggttttgcccgcaac
ctgccgtggacgctgaaatcacatcgtgaagatgctaatggcgtagcgctgacttttgaa
ttgacacaaagcgaagagacgaaaaaattctggctgcacgactttactctgttagcgcat
ttccgcgtggataaaaactgtgaaatcgatcttgaagcacacggcgaatttgaaaccacc
tctgccctgcatacctactttaacgtgggtgatatcgctaaggtaagcgtcagtgggctg
ggcgatcgcttcattgataaagtaaatgacgcgaaagaagatgtactgaccgacggtatt
cagaccttccctgaccgtaccgatcgcgtgtatctgaatccgcaagattgcagcgtgatt
aatgatgaagcgctgaatcgtattatcgccgtaggccaccagcatcatctgaacgttgta
ggctggaacccgggaccggcgctttcagttagcatgggcgacatgccggacgatggctac
aagacctttgtttgtgtagaaacagcttacgcctcagaaatgcaaaaagtgaccaaagaa
aaacctgcacatctggcgcaatccattcgcgttgccaaacgttaa

DBGET integrated database retrieval system