KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_16415Help
Entry
ECO55CA74_16415   CDS       T02066                                 

Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:elr03016]
    ECO55CA74_16415
Enzymes [BR:elr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ECO55CA74_16415
Transfer RNA biogenesis [BR:elr03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    ECO55CA74_16415
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AEZ41848
Position
complement(3397541..3398323)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgtagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gaccagataggccagcatgtttttactgctcatcgtctggaccgacccacttctggtgtg
ttgttgatgggattatccagcgaggccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgcggctggttgatggaagaagcggtgctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggcccgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaaccggacgc
aaacatcagcttcgccgacatcttgcccatttgcgtcatccgattattggcgatagcaaa
catggcgatttacgccagaatcgcagcggtgctgagcattttggtcttcagcggttaatg
ctgcatgccagtcagttgtcattgacgcatccttttactggtgagccgctgactattcac
gcgggcctggacgacacctggatgcaggcgttatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system