KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_16495Help
Entry
ECO55CA74_16495   CDS       T02066                                 

Definition
(GenBank) putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase
  KO
K06968  23S rRNA (cytidine2498-2'-O)-methyltransferase [EC:2.1.1.186]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:elr03009]
    ECO55CA74_16495
Enzymes [BR:elr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.186  23S rRNA (cytidine2498-2'-O)-methyltransferase
     ECO55CA74_16495
Ribosome biogenesis [BR:elr03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    ECO55CA74_16495
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RlmM_FDX FtsJ DUF4222 MIT_C
Motif
Other DBs
NCBI-ProteinID: AEZ41864
Structure
PDB: 

Position
complement(3414682..3415782)
Genome map
AA seq 366 aa AA seqDB search
MNKVVLLCRPGFEKECAAEITDKAGQREIFGFARVKENAGYVIYECYQPDDGDKLIRELP
FSSLIFARQWFVVGELLQHLPPEDRITPIVGMLQGVVEKGGELRVEVADTNESKELLKFC
RKFTVPLRAALRDAGVLANYETPKRPVVHVFFIAPGCCYTGYSYSNNNSPFYMGIPRLKF
PADAPSRSTLKLEEAFHVFIPADEWDERLANGMWAVDLGACPGGWTYQLVKRNMWVYSVD
NGPMAQSLMDTGQVTWLREDGFKFRPTRSNISWMVCDMVEKPAKVAALMAQWLVNGWCRE
TIFNLKLPMKKRYEEVSHNLAYIQAQLDEHGINAQIQARQLYHDREEVTVHVRRIWAAVG
GRRDER
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaataaggttgtattgctgtgccgtccgggctttgaaaaagagtgcgccgcagaaatt
accgataaagccggccagcgggagattttcggttttgcccgcgtgaaagagaatgcgggt
tatgtcatttatgaatgttatcaacctgatgatggcgataagttaatccgtgagctgccg
ttcagttcattaatttttgcccgccagtggtttgtggtgggggaactcttgcagcatttg
ccgccagaagatcgtattacccccattgtcggcatgttgcagggcgtagtagagaagggc
ggtgaactgcgtgttgaagttgccgataccaacgaaagcaaagagttgctgaaattctgc
cgtaaattcaccgtgccgctacgcgctgccttgcgcgatgccggggtgctggcgaactat
gaaacgccgaagcgtccggttgtgcatgtattctttattgcaccaggctgctgctatacc
ggttactcatacagcaacaataattcgccgttctatatgggcattccgcgcctgaaattt
ccggcagatgcgccgagtcgttccacgctcaaactggaagaggcatttcatgtgtttatt
cctgcggatgagtgggatgaacgcctggcgaacgggatgtgggcggtggatttaggcgct
tgccctggcggctggacctaccaactggtgaagcgcaacatgtgggtttattccgtcgac
aacggcccgatggcgcaaagtctgatggataccggacaggtgacgtggctgcgggaagac
ggtttcaaattccgtccgacgcgcagcaatatctcctggatggtatgcgatatggttgaa
aaaccggcgaaagttgcggcattgatggcgcagtggctggttaatggctggtgtcgtgaa
accattttcaacctcaaactgccgatgaaaaaacgctacgaagaagtgtcacacaatctg
gcgtatattcaggcacagcttgatgaacatggcataaatgctcagattcaggcgcggcag
ttgtatcacgatcgcgaagaagtgacggtgcacgtccgccgtatctgggctgcggtgggt
ggtcgtcgcgacgagcgataa

DBGET integrated database retrieval system