KEGG   Escherichia coli O55 H7 RM12579 (EPEC): ECO55CA74_23170Help
Entry
ECO55CA74_23170   CDS       T02066                                 

Definition
(GenBank) sorbose PTS component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
elr  Escherichia coli O55:H7 RM12579 (EPEC)
Pathway
elr00051  Fructose and mannose metabolism
elr01100  Metabolic pathways
elr02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:elr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    ECO55CA74_23170
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    ECO55CA74_23170
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:elr02000]
    ECO55CA74_23170
Enzymes [BR:elr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     ECO55CA74_23170
Transporters [BR:elr02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    ECO55CA74_23170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AEZ43171
Position
complement(4837880..4838374)
Genome map
AA seq 164 aa AA seqDB search
MNITLARIDDRLIHGQVTTVWSKVANAQRIIICNDEVYNDEVRRTLLRQAAPPGMKVNVV
NIEKAVAVYHNPQYQDETVFYLFTRPQDALAMVRQGVKIGTLNIGGMAWRPGKKQLTKAV
SLDDDDINAFHELNNLGVILDLRVVASDPSINIIYKINEQLIAN
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacattacgctcgcccgcattgatgaccgcctgatccacggtcaggtcactaccgtc
tggtcgaaagtggctaacgcccagcgcattattatctgcaatgacgaagtttataacgat
gaagttcgccggacattattgcgtcaggctgcgccaccgggaatgaaggttaacgtggtc
aatattgaaaaagccgtcgcggtttatcacaacccgcaatatcaggacgaaaccgttttt
tatcttttcactcgcccacaggatgccttagcgatggttcgccagggggtaaaaataggc
accctgaatattggcggcatggcctggcggcccggtaaaaaacagttaaccaaagcggtt
tcattagatgatgatgatattaacgcatttcatgagttaaataatctaggcgtcatactg
gatttacgcgtcgtagcgtcagatccctcaatcaatattatctacaaaataaacgaacag
ttaatcgcaaattaa

DBGET integrated database retrieval system