KEGG   Esox lucius (northern pike): 105005916
Entry
105005916         CDS       T04894                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X1
  KO
K04829  acid-sensing ion channel 1
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105005916 (asic1)
Ion channels [BR:els04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   105005916 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 105005916
NCBI-ProteinID: XP_028970037
AA seq 558 aa
MPVRIMCSISFSADDEPGGLGKDRFDDRYRKVIKASGEDGREEYQADGCDELDVYDEDED
DTKFYSLPEFFDNCSLHGANHIFSEDKKFSVRQGFWAVVFLLALSAFLLQVYDRVVYYLS
YDHVTMLDERSAPNLTFPAVTFCNYNYFRRSQVSYSDLLFMGQLLGYEDNNFPGFPLAPE
PDRQGSRFSLDEFHTRTRHRIEDMLLECNFRGKECGPEFFKEIFTRYGKCYTFNSGQDNR
PLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLGFG
VAPGFQTFVSCQEQRLTYLPPPWGDCKNTPMDSDFFGSYSITACRIDCETRYLVENCNCR
MVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCQTPCNMTRFGKELSFVKIPSKAS
AKYLAKKYNKTEQYIADNILVLDIFFEALNYETIEQTKAYEFAGLLGDIGGQMGLFIGAS
ILTILELFDYLYEVLKYKLCRCSKKKHKRSNNNDRGAVLSLDDVKRHASCENLRPPGAYP
ANMLPHHPAQGNFEDFTC
NT seq 1677 nt   +upstreamnt  +downstreamnt
atgcctgtccgcatcatgtgcagcatctcattctcagctgatgatgagcccggaggactt
ggtaaagaccgctttgatgaccgttaccgtaaggtgatcaaagccagtggcgaggacggt
agagaggagtaccaagcagatgggtgtgatgaactggacgtgtacgacgaagatgaagat
gacactaagttttacagccttccagagtttttcgacaactgctcactccacggtgccaac
catatcttctcagaagacaagaagttcagcgtgcgtcaggggttttgggccgttgtcttc
ttgctggctctctccgcattcctgctccaggtgtacgatcgcgtcgtctattacctatcg
tacgatcacgtcaccatgctggacgagagaagtgcccccaacttgacctttccagctgtc
accttttgtaactacaactacttccgccgctcccaggtcagctactctgacctgctgttc
atgggccaactgcttggatatgaagacaacaatttcccagggttccctctggcgccggaa
ccagaccgccaaggatccaggtttagcctggacgagtttcacacccgaaccagacatcgc
attgaagacatgttgttggagtgtaacttcagagggaaagaatgtggccctgaattcttc
aaggagatctttacacgctatgggaagtgctacacattcaactctggccaagacaaccgc
cccctgctggtcaccatgaagggggggatgggcaacggactggagctgatgttggatata
cagcaagacgaatacctgccggtctggggagaaacagatgagacgtcattcgaggcgggg
atcaaagtccagatccacacacaggatgagccacccttcattgaccagctgggctttgga
gtggccccggggttccagaccttcgtctcctgccaagaacaacggctgacatacctccca
cccccatggggcgactgtaagaacactcccatggactctgacttcttcggctcctacagc
atcacggcctgccgcatcgactgcgagacgcgctacctggtggagaactgcaactgccgc
atggtgcacatgcctggagatgcgccctactgcaccccagagcagtataaggagtgtgcc
gaccctgctttggacttcctggtggagagagacaatgactattgtgtatgccagacgcca
tgcaacatgacacgattcgggaaggagttgtcctttgtcaagatcccaagtaaagcctca
gccaagtaccttgccaagaagtacaacaagaccgagcaatacatcgctgataacatcctg
gtcctggatatcttttttgaagcgctgaactacgagaccattgagcagacaaaagcctac
gagttcgctggtttgctgggtgatattggtggtcagatgggtctcttcataggggccagt
attctcaccatcctggaactatttgactatctgtatgaggtgttgaagtacaagctgtgc
cggtgctcaaagaagaaacacaagcgcagcaacaacaatgaccggggggccgtcctgagt
ctggacgacgtcaaacgccatgcgtcctgtgagaatctgcggccgccgggtgcgtaccct
gccaacatgctacctcaccatccagcacagggcaacttcgaggacttcacatgctga

DBGET integrated database retrieval system