KEGG   Esox lucius (northern pike): 105005998Help
Entry
105005998         CDS       T04894                                 

Gene name
gpx3
Definition
(RefSeq) glutathione peroxidase 3
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
els  Esox lucius (northern pike)
Pathway
els00480  Glutathione metabolism
els00590  Arachidonic acid metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    105005998 (gpx3)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    105005998 (gpx3)
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     105005998 (gpx3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-GeneID: 105005998
NCBI-ProteinID: XP_010862603
AA seq 228 aa AA seqDB search
MLGTHESLWILPLVLLGLQPPWAEGESLRQVCDPSKGGTIFDYKAKTLNGSRTVSLSEYR
GKTVLIVNVATYUGLTFQYLELNALHEELKNFGFTVLGFPCNQFGKQEPSANHELLASLK
YVRPGNGFIPNFILFEKGDVNGDTEQGLYTFLKNSCPPVGDSFGDPNDRLFWQPLKINDI
KWNFEKFLVGPDGKPLMRWFPRVPVSEVRTDVLKYFRQYLSQYTQNYE
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgctgggcacacatgagagtctgtggatcctacctttggtgctactaggtctgcaacca
ccctgggctgaaggcgaatcacttcgtcaggtgtgtgacccgtccaaaggtggcaccatc
tttgactacaaagctaagacccttaatgggagtcgtaccgtttccctcagtgagtacagg
ggaaagactgtcctcatcgtcaacgtagccacctactgaggtctcaccttccagtatttg
gagttgaatgcactacatgaggagttgaagaatttcgggttcaccgttcttgggttcccc
tgcaatcagtttggaaagcaggagccatcggccaatcatgagcttctggcctctttaaag
tatgtacgaccaggaaatggattcattccaaatttcatactatttgagaaaggggacgtg
aacggagacaccgaacaaggactctacacttttctcaaaaactcctgtccaccggtaggg
gacagctttggggaccccaatgataggctgttctggcagccccttaaaatcaacgacatc
aaatggaactttgagaaattccttgtcggaccggatggaaagcctttgatgaggtggttt
cctcgggtcccagtgtctgaggttcggacagatgtcctcaaatactttcgccaatatttg
tcccagtacacccagaactatgaataa

DBGET integrated database retrieval system