KEGG   Esox lucius (northern pike): 105006245Help
Entry
105006245         CDS       T04894                                 

Gene name
minpp1
Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105006245 (minpp1)
   00562 Inositol phosphate metabolism
    105006245 (minpp1)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     105006245 (minpp1)
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     105006245 (minpp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 105006245
NCBI-ProteinID: XP_010862990
UniProt: A0A3P8XE08
AA seq 462 aa AA seqDB search
MTSSLTKQNVLFRTFSLALTGFSFYSVSNAKVSNIPAIANYFGTKGRYEEVNPYLINDIL
SVNKSLLKPGCTDCTAIHVTAIIRHGTRYPTTKNIKRMQRLYDLVVNEATNTEKWLNDIK
TRWQMWYTDDMDGKLVEKGRDDHRHLAVRLATLFPSLISEENLRSHRIRFITSSKHRCVD
SVVAFQEGLLNLWRVAEVGLSHKINDELMRFFDQCQRFVEDVENNKTALEQVYLFKASAD
MKRVEMNIADRLQVPYSHITSDLVEAAFFLCSYEFSIKSLNSPWCNLFDETDAQVLEYKN
DLKQYWKRGYGHDINRKSSCTLFHDLFSRLDQAALEIRFGQVSEAVTIQVGHAETLLPLL
ALMGFFRDETPLTADNFDLQRGRTFRTSRIVPYAANLVFVLYDCSEGLRLQFLLNETPLK
FPGIHHQAPLYGTVRETYRELLHGCNFEKECELPRPNHNNEL
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgacatcttcattaaccaaacaaaatgtgttgtttaggacatttagtcttgcattgacc
ggtttttcattttattcagtttcaaacgctaaagtttcaaacataccggcgattgctaat
tatttcggaacgaaaggcagatacgaggaggtaaacccttacctcattaatgacattctt
tccgtaaacaaatcccttttgaaaccgggatgtactgattgcaccgctattcatgtaacc
gctattattcggcatggtacacgatatccgactaccaaaaatatcaaaagaatgcaacgg
ctctacgatcttgttgtaaacgaggcaacgaacactgaaaaatggctaaatgacatcaaa
accaggtggcaaatgtggtacactgacgacatggacggaaagcttgtggaaaaggggcga
gatgaccacaggcatctagctgtcaggttggcaactttgtttccatctctgatatcagag
gaaaacctcaggagccatcgtatccgtttcatcactagctctaaacacagatgtgtggat
agcgttgtagctttccaagagggcctgctcaacctttggagagtggcagaagttggactt
agccacaagatcaatgatgagttgatgaggttctttgaccaatgccagagatttgttgag
gatgtggagaacaacaaaactgccctagaacaggtctaccttttcaaggcctcagcagat
atgaaaagagtcgaaatgaatattgctgaccgacttcaagttccatacagtcacatcaca
tcagatttggttgaggctgccttcttcctgtgctcgtatgaattttccatcaaatctttg
aactccccatggtgcaacctgtttgatgagactgacgcccaagtgctggagtacaaaaat
gacctaaagcagtactggaagaggggttatggtcatgacattaaccggaagtccagttgt
actctctttcatgacctattcagtcgccttgatcaggctgctcttgagatcaggtttggg
caagtatctgaggctgttaccatccaagtgggtcatgccgagaccctcctgccgcttttg
gcgcttatgggcttcttcagagacgagacgcccctgactgccgacaactttgacctgcaa
cgtggtcgcaccttccgcaccagccgcatcgtgccatacgcggccaacctggtctttgta
ctgtatgactgcagcgaagggcttcgtctgcagttcctgctgaatgagacgcctctaaaa
ttccctggtatccaccaccaggctccattgtatggtacggtgagagagacctacagggag
ctgctgcacggctgcaattttgagaaggagtgtgagctgcccagacctaatcacaacaat
gagctgtaa

DBGET integrated database retrieval system