KEGG   Esox lucius (northern pike): 105006613
Entry
105006613         CDS       T04894                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
els04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    105006613 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105006613 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 105006613
NCBI-ProteinID: XP_010863542
AA seq 78 aa
MNVKILTLVIVLLVSLLCSASAGPIMASTEHGAVLEEAGGVRRVAQQNPGRGGQSHRPAG
WKRRRPRPRLSHKGPMPF
NT seq 237 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgttccgcc
agcgctggtcccatcatggcctccacggagcatggcgcagtgctagaagaggcagggggt
gtgagaagggtggctcagcagaaccccggcaggggcggccagagccacagaccagccggc
tggaagaggagacgcccacgaccccgtctctcccacaaggggcccatgccattctag

DBGET integrated database retrieval system