KEGG   Esox lucius (northern pike): 105007006
Entry
105007006         CDS       T04894                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 2
  KO
K13723  endoplasmic reticulum aminopeptidase 2 [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105007006
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105007006
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105007006
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N SDP_N
Other DBs
NCBI-GeneID: 105007006
NCBI-ProteinID: XP_010864060
AA seq 935 aa
MVWVRLVVLGLLSLAIPLQASEPPNPTAGPPPLDTGSLSFPWSRLRLPGYIVPLHYHLVL
HPNLTTLSYTGTVRIELRVENNTNWVVLHSNRLRITWATVLDQNLAPLSDRALPVLHHPT
HEQAAVFSPKILGCGQKYFLFLEFEAELEEGFYGFYKSSYRTSSGETRILASTHFEPTSA
RTAFPCFDEPSFKANYTISIRRSPAHTALSNMPVEKTVVLDDVLVEDRFTASVRMSSYLV
AFIVCDFSSVSETTASGVKVSVYAAPDKWQQTHYALKAAVKLLEFYEEYFNINYPLPKQD
LVAIPDFQSGAMENWGLITFRETSLLYDPATSTGSDRLWVTKVIAHELAHQWFGNLVTME
WWNDIWLNEGFAKYMEYISVEATYPELQVEDYLLNTCFAAISQDSLNSSRPISSAAESPT
QIKEMFDTMSYNKGACVLHMLRQYMTDKVFQSGIVRYLRRYIYGNARNQDLWDSLANTCS
EDDFTSDEHCYNRRQAAKNKYVGEHLDLTTMMNTWILQKGVPLVTVARQGSRLLLKQERF
LRTTHPSDPAWPGLQQGYLWHIPLTYRTDSSPSIHRHLLTTPTDSVEVGEEVGWVKVNVD
MAGYYLVHYDGSGWDVLTQLLKDNHTALSYMDRTHLIHNAFQLTTAGRLSINKALDLIGY
LQSESHTVPLLEGLAHLEAFYRMVERIDIPDITQNLRTYILGYFRSVIDGQTWSDKGSVS
ERRLRSELLSLACHLEHRPCMEQAKHRFTRWLDSNSTLRLPADVTETVYSVGAQEDRGWE
ALLNTYTRSLSETHKHKILSALDSSQDTNKLHRLLELGLEGHVIRTQDLDSVIVMVARNP
RGHHLAWSYVQKHWSTLVEKFQLGSFSIRNIIIGTTAQFSSTEELSEVRVFFESIRKQGS
QLRVMQVAMDNIQKNILWLQRNLGTLRSWLDQGIV
NT seq 2808 nt   +upstreamnt  +downstreamnt
atggtctgggtcagattggtggttctgggcttgttgtctctggctatccccctacaggcg
tctgagccccccaaccccaccgcggggccgcctcccctggatacgggtagcctctcattt
ccttggagccgcctccgtcttcctggttacattgttccgctccactaccaccttgtgctc
caccctaacctcaccacgctcagctacaccggcaccgtccgtatagagctccgggttgag
aacaataccaactgggtcgtgctgcacagcaacaggctccgcatcacttgggcgacagtg
ctggaccagaacctggctcccctgtcggaccgggcgctcccagtgcttcaccatcctacc
catgagcaggcagccgtcttttctcccaaaatactcggctgtgggcagaagtactttctg
tttctggagttcgaggcggagctagaagaaggcttctacggcttctacaagagcagctac
agaacaagtagcggagagacacggatcctggcctccactcattttgagccgacaagtgct
cggacggcgttcccctgtttcgatgagccgagcttcaaggctaactacaccatcagtatc
aggagaagcccagcacacactgccctgtctaacatgcctgtggagaagaccgtggtcttg
gatgacgtcctagtggaggatcgtttcaccgcgagcgtgaggatgagctcatacctggtg
gcctttattgtgtgtgacttcagttctgtcagcgaaacgacggcctctggcgtcaaggtg
tctgtctatgctgctcctgacaaatggcagcagacccattatgccctgaaggctgcagtc
aaactactggagttctacgaggaatactttaatatcaactacccactgcctaaacaagac
ctggtggccatcccagacttccagtctggagcgatggagaactggggtctgatcaccttc
agagagaccagcctgctttatgacccggccacctccacaggctctgataggctctgggtt
accaaagtaattgcccatgagctcgcccaccagtggtttgggaacctggtgaccatggag
tggtggaatgacatctggttgaatgagggttttgccaagtacatggaatacatctcagta
gaggccacataccccgaactccaagtggaggactaccttctgaacacctgcttcgctgca
attagtcaagactctctaaactcctcccgccccatctccagtgcggctgaaagccctaca
cagattaaagagatgtttgacacaatgtcctacaataagggagcatgtgtcctgcacatg
ctcagacagtatatgactgacaaagtgttccagagtggaattgtgcgttaccttcggagg
tacatttacggtaatgcacgcaaccaagacctgtgggacagcttggccaacacctgttca
gaagatgacttcacctcagatgaacactgctacaaccgcagacaggcagctaagaacaaa
tatgttggagagcacctggacctgacgaccatgatgaacacctggatcctgcagaagggt
gtccccttggtaacggttgctaggcaggggtctcgtctgttgcttaaacaggagaggttc
ctgaggactacacatccctcagatccagcttggcccggtctgcagcaggggtacctgtgg
cacatccctctgacatacaggactgacagctcacctagcatccatagacacctactgacc
accccgacagacagtgtggaggtcggggaggaggtgggctgggtgaaggtgaatgtggac
atggctggttattatctggtccactatgatggttcaggatgggatgtgctgactcaactt
ctgaaggacaaccacacagccctcagctacatggacagaacacaccttattcacaatgct
ttccaacttaccacggcaggtcggctgtcaatcaataaagccttggaccttattggttac
ctacaatcagagagtcacaccgtgccgctccttgaggggttggcccatctggaagccttc
tacaggatggtggaaaggattgacatacctgacatcacacaaaacctcaggacatacatc
ctggggtatttccgcagtgtgattgatggtcagacctggagcgacaagggctctgtgtct
gagaggaggctgcggtcagagctcctctcactggcctgccatctagagcatcgcccctgt
atggagcaggccaagcaccgctttactcgctggctagattcaaacagcacactcaggctg
ccggcagacgtgacagagacagtgtactcagtaggggcccaggaggaccgaggatgggag
gctttactcaacacatacacccgttccctctcagagacacacaaacacaaaattctctct
gccctggacagtagccaagacacaaacaaactacacaggttgttggagctgggtttagag
gggcacgtgatccgtacccaggacttggactccgtcattgtcatggtagccaggaacccc
aggggacatcacctggcgtggagctacgtccagaaacactggagcaccctggtggagaag
ttccaactgggatcgttctctattaggaacataatcatcggcaccacagcccagttctcc
tccacagaggaacttagtgaggtgcgtgttttttttgagtcaatccgtaagcaggggtct
cagctgagggtgatgcaggttgccatggacaacatacagaaaaacatcctctggctgcaa
agaaacctgggaactctgaggagctggctggaccaagggatagtttga

DBGET integrated database retrieval system