KEGG   Esox lucius (northern pike): 105007007
Entry
105007007         CDS       T04894                                 

Definition
(RefSeq) leucyl-cystinyl aminopeptidase isoform X1
  KO
K01257  cystinyl aminopeptidase [EC:3.4.11.3]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105007007
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.3  cystinyl aminopeptidase
     105007007
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105007007
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 105007007
NCBI-ProteinID: XP_010864061
UniProt: A0A3P8Y1X6
AA seq 1034 aa
MEDPFDSERASLPRNMIENSMFEEEPDVVDLAKDSTAFPGFPALDPDEVVYEPRSSRLLV
RGLGENDLDDEEEDYESSARLLGMSFMNRSSARSPSSSPYTRQAPPRSCSCPSTRKLVVG
VFILVLVSSMAMALYFLPGCTFTKAGCHKDNSSTPIEPVYPNSTTGEPFPWNEPRLPASV
RPLNYNLSLTPNLTSKTFTGRTVINMMIQHDTKRVVLHSSDLNITKATFQVGKDKSVEVK
VLEYKPWQLIAVSFPEDLKAGQVCVLTLEYKANLSNTYDGFYNSSYNDVTGAKRVLAATQ
FEPQAARKAFPCFDEPAFKATFLVRITREPEYITLSNMPKAKTTTLPSGLLEDEFEQTSV
NMSTYLVAFIVANFTSVSRNVSNTLVSVYSVAEKKEHTHYALDAASKLLQFYNTIFDVDY
PLRKLDLVAIPDFLAGAMENWGLITFRETTLLVGNQSSPLDKQLVANVVAHELAHQWFGN
LVTMRWWNDLWLSEGFATYWQYTSLTTVFPQLYPGDEFLEVRFKAMAKDSLNSTHSVSVS
SQMTSPEDVLEMFDSVTYEKGASLLLMLNSTLPDGQFRKGLIEYLNKYRGSNSVTDDLWN
SLTQAQVLPQQESVSDMMRTWTLQKGFPLVTVSCKDGQVNLTQEPFLLSRENTTHTSSLW
HIPVSYVNDSCSQAPSCRQLFVLRNKTATLKVSDSVKWLKLNYMNTGFYIVHYGVEGWAA
LINTLKTDISSFTAHDRASLIHNMFALSRLGRVSFPQVLSLLGYLTKETETAPLKEALSQ
LSSVYRLLDKRPDPYLVSRMKGYILNLFGPLINSLDWGEEQSVSRQELRSALFEMACGLG
QENCTDQAKVLYDQRTNSTQPKIIPGDLERVVFSVAAQSDSGWLSLLEAYGHTTYDSEKR
KILQALASTQDTRRIVWILNAGLQGSIIQTQELPLLISTVSDGFAGHLFVWNFVKENWDS
IIEKFPLGSYPIQSIIKSTTSQFSTQMHLEEVQGFFSGLKERGHPMRSVQEALETIRLNQ
DWMDRNLPALRQSL
NT seq 3105 nt   +upstreamnt  +downstreamnt
atggaggacccctttgacagtgagcgagcgtccctgcccaggaacatgatcgagaacagc
atgtttgaggaggaacctgacgtggtggacctggccaaagactccacagccttcccggga
ttcccggcgttggacccagatgaggtggtgtacgagccccgtagctcccgtctgctggtg
cgtggtctgggagagaacgacttggacgatgaggaggaggactatgagtcgtcagcccgc
ctactgggcatgtccttcatgaacagaagctctgcacgcagtcctagctcctccccttat
accagacaggccccacctaggtcttgttcctgcccctcgactcgtaagctggtggtgggc
gtgttcatcttggtactggtgtcttccatggctatggctctctactttctgcctggctgt
accttcactaaggctggctgtcataaggacaactcctctacacctattgagcctgtctat
cctaacagcaccactggggagccgttcccctggaatgagccccgccttccagccagtgtt
cggccattgaactacaacctctccctaactcccaacttgacttcgaagaccttcaccgga
cgcactgtaatcaacatgatgatacagcatgacaccaaacgcgtcgtactgcacagctct
gacctcaatatcaccaaggcaacctttcaggttggaaaggacaagagtgtagaagtgaag
gtgttggagtacaagccatggcagctgatagctgtgagcttcccagaggatctgaaggca
ggtcaggtgtgtgtgttaacactggaatacaaggccaacctatcaaacacctacgacgga
ttctacaacagctcctacaacgatgtgactggagctaagagggtcctagctgccacccag
tttgagccccaggccgccaggaaagccttcccttgttttgatgagccagcctttaaagcc
accttcctggtcaggatcaccagagaacctgaatacatcactctgtccaacatgcccaag
gctaagacgactacattacccagcggcctgctagaggatgagtttgagcagacaagtgtt
aatatgagcacttacctggtggccttcatcgtagccaacttcaccagcgtcagtagaaat
gtctccaataccctggtgtcagtgtactctgtggcagagaagaaggaacacacacactat
gctctggacgccgcctccaaactgctgcagttctacaacaccatctttgatgttgactac
cctctgaggaaactggacctggtggctatcccagacttcctggcaggagcgatggagaac
tggggtctgatcaccttcagagagaccaccctgctggtgggtaaccagtcatcccctctg
gacaaacagctcgtggctaacgtggtagcccatgagctggcccaccagtggtttgggaat
ctggtgaccatgcgttggtggaatgacctgtggctgagcgagggcttcgccacctactgg
cagtacacgtccctaaccacagtgtttccccagctgtacccaggtgatgagttcctggag
gtgcggtttaaggcgatggccaaggattctctgaactccacccactcagtgtcagtctca
tcccagatgaccagtcctgaagacgtgttggagatgtttgactcggtcacctatgaaaag
ggtgcgtccctactgctgatgttgaactccactctaccagacggccagttccggaaggga
ttgattgagtacctgaacaaatacaggggctctaactctgttactgatgacttgtggaac
agcctcacacaggcccaagtgcttccccagcaggagagcgtgtcagacatgatgagaaca
tggacgctgcagaaaggcttcccattggtcactgtcagctgcaaggatggccaggtgaac
ctcacacaggaacctttcctactatccagagaaaacaccacacacacctccagcctgtgg
cacatcccagtgtcgtatgttaacgacagctgtagccaggccccttcctgcaggcagctg
ttcgttctccggaataagacggccactctgaaggtgtcagacagtgtgaagtggctgaag
ctgaactacatgaacacaggcttctatatagttcactatggagtggagggctgggcagct
ctcataaacactctgaagactgacattagctccttcacagcccacgaccgcgcttctctc
atccacaacatgttcgccctgtccaggctgggtcgggtgtccttcccgcaggttctcagt
ctgttgggatatctcaccaaggagaccgagactgcccctctgaaagaggccctgtcacaa
ctttcgtctgtctaccgcctactggacaaaagacctgacccatatttggtgtcacgaatg
aagggatacatcttgaatctttttggccctctgataaacagtctggactggggagaggag
cagagtgtatccagacaggagctgaggtcggccctgtttgagatggcctgcggtctggga
caagagaactgtacggaccaggccaaggtcctgtatgatcagaggaccaactcaactcaa
cccaaaataatccctggtgatctggagcgagtggtgttctctgtggcggcccagtctgac
tccggttggctgtctctcctggaggcttacggacacactacatatgactctgagaagagg
aagatactgcaggctctggcctccacccaggacacacgacgaatcgtatggattctgaac
gcaggactgcagggatcgattatccagacccaggagctgccgttgctcatcagcaccgtg
agcgatggctttgctggccacttgtttgtctggaattttgtcaaagagaactgggacagt
atcattgagaagtttccattggggtcttatcccatccagagcataatcaagtccaccacc
tcccagttctctacgcagatgcacctggaggaggtccagggcttcttctcgggtcttaag
gagcgggggcatccgatgcgcagtgtccaggaggctttggagaccatcagactgaaccag
gactggatggacaggaaccttccagcactcagacaatcgctctaa

DBGET integrated database retrieval system