KEGG   Esox lucius (northern pike): 105007022Help
Entry
105007022         CDS       T04894                                 

Definition
(RefSeq) bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
els  Esox lucius (northern pike)
Pathway
els04060  Cytokine-cytokine receptor interaction
els04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    105007022
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105007022
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:els01001]
    105007022
Enzymes [BR:els01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     105007022
Protein kinases [BR:els01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   105007022
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Activin_recp Cadherin_C_2 APH Sigma_reg_N
Motif
Other DBs
NCBI-GeneID: 105007022
NCBI-ProteinID: XP_028971477
AA seq 1218 aa AA seqDB search
MCSCSSSVKAGEKERTFWRNRPSRMSPSAMAALGRMSFLALGLCVILLLSPVAAAQSEER
ECAFNDQQPQYEEQRGGGPMSRENSTVRCIEGSRCYGLWEKKKDGDTLLVKQGCWTHEDK
QECHEDRCVVTTTPSQIQNGTYRFCCCSTNMCNVNFTEDFPPPSPTSAQLYPQPVYREET
IVIALASVSIVAVLMVALFCGYRMMSGDRKQGLHNMDMMEAAASEPNLHLDSLKLLELIG
RGRYGSVYKGSLDERPVAVKVFTYQNRQNFVNERAIYRIPLLEHENIARFIAGDERLTPD
GRMEYLLLMEYYSRGSLCRYLSHQAGDWMSCCRLTHSVTRGLAYLHTEILTADIYKPAVS
HRDLNSRNILVKNDGTCVISDFGLSMKLTGNRLVRPGEEDNAAISEVGTIRYMAPEVLEG
AVNLRDCESALKQVDMYSLGLVYWETFMRCTDLFPGEAVPEYQMAFQAEAGNHPSFEDMQ
VLVSREKERPKFPEAWKENSLAVRSLKETMEDCWDQDAEARLTAQCAEERMAELLLIWDR
NKPVSPTVNPMTTALQNPMTTALQNPMTTALQNPMTTALQNERNLSHSRRPPKVTPYPDY
SYIEDHEGHLVKNLPGGATSSSAPGGSGTGPAGPEKNRNSINYDRQQAQARLPSPESSGA
SLSTTTGLTPNTVMTTISESGHGEDSSGMLGGAVIMPVCLQLTQEDFETTKLDPKEVDKN
LKESSDENLMEHSQKQFSAPDPLSSGSSSLLYPLIKLASEVTGASAVGDPPTAAFPLPKQ
QNLPKRPTTLPLNTKTKEGSESSRLKFGKHKSNLKQVETGVAKMNTVATAAEPHLVTITS
NGMSGVVGGNGVRSGVGTLVVNGYLNGGVASSSGGGAPFGTTNPAGPQSEVGGATSLLQS
QLSGEDSRLTLNPSPDEHEPLLRKEPPAARHQRPGSHLATRPNSNNNNNSLVGVAPPARG
IVGPPVEGRSAPFIAAPLHVSTLTTPSPGTVSLSTPSLGPVSLSVPSPGPVSLSVPAPEP
VSLSVPAPEPVSLSVPAPEPVSLSVPAPEPVSLSVPTPKPVSLSVPAPKPVSMSVPAPEP
VSLSTHTPGPLSVPKTTPAPVSAPVAQQESAQLRQPKPRRPERPCSLDLSVSSSHDSSSG
DCSSLDGQGGSGEKIKRRVKTPYSLKRWRPSTWVVSTETLVGEVNNNSGASRSKSSTAVF
LVGGGTTTITSDPNITCL
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgtgctcgtgtagctcaagcgttaaagctggcgaaaaagagagaactttttggagaaac
cgcccgtcccgaatgtctccatcagccatggcagccctgggccgaatgtcgttcctggct
ttggggctgtgtgtcatcctgcttctcagtcccgtcgctgctgcccagagtgaggagcgt
gagtgtgcttttaatgaccagcagcctcagtatgaggagcagcgaggaggaggacctatg
agcagggagaattctactgtacgatgcatcgaggggtcccgctgctacggcctctgggag
aagaagaaagacggggacacactgctggtcaaacagggttgttggactcatgaggacaag
caggagtgtcatgaggaccgctgtgtggtgaccacgaccccgtctcagatccagaatggg
acctatcgcttctgctgctgcagcaccaacatgtgcaacgtcaacttcactgaggacttc
ccaccgcccagccccacgtccgcacagctctacccgcagccagtgtatcgggaggagacc
atcgtgatcgccctggcgtctgtctccatagtagcggtgttaatggtggcgctgttctgt
gggtacaggatgatgagtggggacaggaaacagggactacacaacatggacatgatggag
gcagcagcctcagagcccaacctccaccttgacagccttaaactactagagttgattggc
agaggacgatatggctcggtctataagggttcgttagatgagcgtccggtggcagtcaag
gtgttcacctaccagaaccggcagaactttgtcaacgagcgtgctatctaccgcatcccc
ctgttagagcacgagaacatcgcccggtttatcgcaggagatgagagactaacacccgac
ggacgcatggagtatctgctgctcatggagtattactctcgcggttctctgtgtcggtac
ctgagtcaccaggccggagactggatgagctgctgtcgtctcactcactctgtgaccaga
gggctggcctacctccacactgaaatactgacagcagacatctacaagcctgcggtctct
caccgagacctaaacagccggaatattctggtgaagaacgatgggacctgtgtgatcagt
gactttggcctgtccatgaagctgacagggaaccgactggtcaggcctggagaggaggac
aacgctgccatcagcgaggtggggaccatccgttacatggctccagaggtcctggagggg
gcggtcaacctcagggactgtgagtccgctctgaagcaggtggacatgtactcccttggc
ctcgtctactgggagaccttcatgaggtgtaccgacctcttcccaggagaggcggtgcct
gaataccagatggcgttccaggctgaggctgggaaccacccgtccttcgaggacatgcag
gtcctggtgtccagagagaaggagagacccaagttccctgaggcctggaaggagaacagc
ctggcggtgcgctccctgaaggagaccatggaggactgctgggaccaggacgctgaggct
cgtctgacagctcaatgtgcagaggagcgcatggcggagctcctgctgatctgggatcgg
aacaaacctgtcagtcctactgtcaaccccatgaccactgcactgcagaaccccatgacc
actgcactgcagaaccccatgaccactgcactgcagaaccccatgaccactgcgctgcag
aacgagaggaacctgtcccacagtcgcaggcccccaaaagtcaccccctacccagactac
tcctacatcgaggaccatgagggccatttggtgaagaacctcccaggtggggccacctcc
agcagcgcacctgggggatctggcaccggcccggcgggccctgagaagaatcggaactcc
atcaactacgaccgccagcaggctcaggctcggctgcccagcccggagagcagcggggct
agcctctcaaccaccacagggttgacgcctaacaccgtcatgaccaccatatcagagtct
gggcacggggaggactcctctggaatgctgggtggtgctgtgataatgcccgtatgtctg
cagctgacccaggaggactttgagaccaccaagctggaccccaaggaggtcgacaagaac
ctgaaagagtcctctgacgagaacctgatggagcacagccagaagcagttctctgctccg
gaccccctgagctcggggtcgtcctccctgctgtaccccctcatcaagctggcttcggag
gtgacaggggccagtgctgtgggggaccctcccactgccgcgttccctttgcccaagcag
cagaacctccccaagcggcccaccaccctgcccctcaacaccaagaccaaggagggctcg
gagtcctcgcggctcaagtttgggaagcacaagtccaacctgaagcaggtggagacgggc
gtggccaagatgaacactgttgccacggcagccgagccacacctggtaaccatcaccagc
aatggaatgtctggggtcgttggcgggaacggggtacgcagtggagtgggcacgctggtg
gttaacggttacctgaatgggggcgtggcctcctcctcaggaggtggggctccttttggg
accaccaatccagcgggccctcagagtgaggtgggaggagcaacatccctgttgcagagc
cagctgagtggagaagacagccgactcaccctgaaccccagccccgacgaacacgagccc
ctcctgaggaaggagccgccggctgcacgtcaccagagacccggcagtcacctggcaacg
cgtcccaactccaacaacaacaacaacagcctggtgggggtggctccgcctgccaggggg
atcgtgggtcctcctgttgagggccgatctgcaccctttattgcagcccctctacatgtc
tctactctaactaccccatcacctggaactgtctcactgtctaccccctcacttggacct
gtctcactgtctgtcccatcacctggacctgtctcactgtctgtccccgcacctgaacct
gtctcattgtctgtccccgcacctgaacctgtctcactgtctgtccccgcacctgaacct
gtctcactgtctgtccccgcacctgaacctgtctcactgtctgtccccacacctaaacct
gtctcactgtctgtccccgcacctaaacctgtctcaatgtctgtccccgcacctgaacct
gtctcactgtctacccacacacctggacccttatctgtccccaaaacaacccctgcccca
gtttcagccccagtggcccagcaggagtctgcccagctcagacagcccaaacccaggcga
cctgagaggccctgctccctggacctgtctgtttcctcctcacacgacagctcttcaggt
gattgctcttcgctcgatggccagggtggttcaggtgagaagatcaagcgtcgcgtcaag
acgccgtactccctgaagagatggcgaccctccacctgggtggtctccacggagacgctg
gtcggcgaggtaaacaacaacagcggcgcatctcggtccaagtcctcaaccgctgtgttc
ctggtggggggcgggactaccaccataacctctgacccaaacatcacctgcctgtga

DBGET integrated database retrieval system