KEGG   Esox lucius (northern pike): 105007069
Entry
105007069         CDS       T04894                                 

Definition
(RefSeq) retinol dehydrogenase 7 isoform X1
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
els  Esox lucius (northern pike)
Pathway
els00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    105007069
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     105007069
SSDB
Motif
Pfam: adh_short adh_short_C2 DUF1776 Phage_rep_O KR
Other DBs
NCBI-GeneID: 105007069
NCBI-ProteinID: XP_019900476
UniProt: A0A3P8YTP8
AA seq 345 aa
MDMDSVYQYLGFQAQTSDDSESSRVNLWLYGVATSVVLWTIGWLYRDSLEIEDINQKHVF
VTGCDSGFGNLLCKRLDRRGFRVIAGCLTEKGADDLKRATGPYLKTVLLDVTSTASIQKA
MDWTKQEVGEKGLWGLVNNAGRSLPMGPSEWMKLEDFNSTLKVNMTGVIEMTLTFLPLIK
QAQGRIVNVASVLGRVAANGGGYCISKFAVESFSDCLRRDIHYFGIKVCIIEPGFFKTAV
TSLDPIERELHRLWNQLTPEVKASYGDKYLDNYIQIQRLIMNAVCDSDLSKVTNCMEHAL
ISAYPRTRYSAGWDAKFGWIPLSYMPSCVIDIGLKLVMPRPAKSV
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggatatggattctgtgtatcagtatttaggatttcaagcacaaaccagcgatgattca
gagagttcaagggtcaacctgtggctgtatggagtagctacctcagtggttctgtggact
ataggatggctatacagagacagtctggagatagaggacatcaaccagaagcatgtattt
gtgacagggtgtgactctggctttgggaacctgctatgtaaaaggttggaccggcggggt
ttcagggtgatagctggctgtctgacagagaaaggagctgatgacctaaagagggcgact
gggccatacctaaagacagttctactagatgtgacgagcacagcgagcatacagaaagct
atggactggaccaagcaggaagttggagaaaaaggactgtgggggcttgtgaacaacgca
ggacgctccctgcccatgggtccatctgagtggatgaagctagaggactttaacagcacc
ctgaaggtcaacatgacaggggtgattgagatgaccctcaccttcctgccccttatcaaa
caggcccaggggaggattgtcaatgtggcttcagtactgggcagagtcgctgctaatggt
gggggatactgcatctccaagttcgctgtggagtctttctctgactgcctcaggagggat
atccactactttggtatcaaagtgtgcataattgaaccaggattctttaagacagctgtt
actagtctggaccccattgagagagaattgcaccgcctgtggaaccagctcactcctgaa
gtgaaagccagctatggtgacaaatacctggacaactacatacagatccaacggttgatc
atgaatgctgtttgtgactctgacctgagtaaagtcactaactgcatggagcatgccttg
atttctgcctacccccgtacccgctacagtgccggctgggatgccaagttcgggtggata
cccctttcttacatgccgtcttgtgtaattgatattggcctgaaactggtaatgccacgt
cctgcaaagagcgtgtag

DBGET integrated database retrieval system