KEGG   Esox lucius (northern pike): 105007948
Entry
105007948         CDS       T04894                                 

Gene name
gpn2
Definition
(RefSeq) GPN-loop GTPase 2
  KO
K24104  GPN-loop GTPase
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105007948 (gpn2)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105007948 (gpn2)
SSDB
Motif
Pfam: ATP_bind_1 AAA_31 AAA_30 AAA_22 CLP1_P MeaB AAA_18 AAA_33 AAA_17 AAA_24 AAA_16 AAA KTI12 CbiA AAA_5 ArsA_ATPase SRP54 AAA_28
Other DBs
NCBI-GeneID: 105007948
NCBI-ProteinID: XP_010865394
UniProt: A0A3P8Z4W2
AA seq 313 aa
MDNQPLRSPSLRFGQVVIGPPGSGKTTYCRGMQEFLGHLGRKVVVINMDPANEGLPYPCA
VDISELVTLDDVMEGLKLGPNGGLLYCMEYLEANLDWLETKLEKYSDSYFLFDCPGQVEL
YTHQNSVKNVFAQLAKWNFRLTAVHLVDSHYCADPAKFISVLCTSLSTMLHVELPQVNVL
SKMDLIEQYGKLAFNLDFYTEVMDLTYLLDHLAADPFFRKFLKLNEKLADVIQDYSLVSF
VPLNVQEKESMTQVLRTVDKANGYCFGDLEERNLQAMMSAAVGADFQFNSTLGVQERYVG
DGEKTLEEEVMDL
NT seq 942 nt   +upstreamnt  +downstreamnt
atggataaccagcccttgcggtctccatccttgcgctttggccaggtggttataggacct
cctggctctggtaaaaccacatactgtcgggggatgcaggagtttttgggccacttggga
cgcaaagtagttgtcattaacatggacccagcaaatgaggggctcccatacccctgtgct
gtggacatttcagagctggtcaccctggatgatgtgatggaaggattgaagctggggcct
aatggtggactcctgtactgcatggagtacctggaagccaacctggactggctggaaacc
aagttagagaaatatagtgacagttactttctctttgattgtccgggtcaggtggagctg
tacactcaccagaattctgtaaaaaatgtatttgctcagctcgccaagtggaactttagg
ttgactgcagtacatcttgtagactctcattactgcgcagaccctgccaagttcatctca
gtgctgtgcacatccctgtccaccatgctgcatgtagagctgccccaagtcaacgtcctg
tccaagatggacctcatcgagcagtacggaaaactagcattcaacctggacttttacaca
gaggttatggacctgacatatttgctggatcacctggctgcggaccctttctttaggaag
ttcctcaaattgaatgagaaattggcagatgtcatacaagactacagccttgtttctttt
gtacctctcaatgtgcaggagaaagagagcatgacacaggttctgcggacagtggacaag
gccaacggctactgcttcggtgacctggaggagaggaacctgcaagcaatgatgtcagcc
gctgtgggagcagacttccagttcaactcaactctaggagtgcaagagcggtatgttgga
gatggtgaaaagactttggaggaggaggtgatggatctttag

DBGET integrated database retrieval system