KEGG   Esox lucius (northern pike): 105007986Help
Entry
105007986         CDS       T04894                                 

Definition
(RefSeq) leukotriene B4 receptor 1
  KO
K04296  leukotriene B4 receptor 1
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105007986
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:els04030]
    105007986
G protein-coupled receptors [BR:els04030]
 Rhodopsin family
  Lipid
   Leukotriene
    105007986
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srx Plasmodium_HRP Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 105007986
NCBI-ProteinID: XP_010865449
UniProt: A0A3P8XQM3
AA seq 463 aa AA seqDB search
MVLDLSASTAFTASTAFTAFTASTAFTASTASTAFTASTAFTASTASTASTAPTASTAST
AFTASTAFTASTAFTASTAFTAFTASSQYSSGLPAPSSPPLPISHQIGIFILVLAFVVGF
PGNLFLVWSVVCRVRQRSVTCLLVLNLAVADALVLLSIPLFLRFLAGRRGWEFGAAACKT
IHYLCCVNMNVSIYLIGLMSIDRWLAVTKPFLSQKMRTKQTLKAVLLGIWVLAFIMALPM
PFYRSNLQMNSSVTICVPYHWNSVGHQVFQYLFETILCFFLPFTFITVCYGTVLCRLRAV
MLQRKGRVQRGQRGNRLIILIIGAFAGCWLPYHIVNILQVTGLLSGNNSLIKAALVARPN
TTAFAFLSSSVNPLLCVLAGSPHFHKAGLSFIAELFEGTNPERRTSTSFSRSTRTSRSSS
FAPGDSFAMRKLSFKPGRKVKGKDEDGDVLAERQGALIMVKAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggtattagatctctccgcctccacggccttcacagcctccacggccttcacggccttc
acggcctccacggccttcacggcctccacagcctccacggccttcaccgcctccacggcc
ttcacagcctccacggcctccacagcctccacggcccccacagcctccacagcctccacg
gccttcaccgcctccacggccttcacagcctccacggccttcacagcctccacggccttc
accgccttcacggcctcctcgcagtactcctctggcctccccgctccctcttcccctcct
ttacctatctcgcaccagatcggcatcttcatcctggtcctggcgttcgtggtcggcttc
cccggcaacctgttcctggtgtggtctgtggtgtgccgcgtgaggcaacggtccgtcaca
tgcctcctcgtcttaaacctggcggtggctgacgccttggtgttgctcagtatcccgctc
ttcctgcgcttcctggcgggcagacggggctgggagttcggggcggcagcgtgcaagacc
atacactacctgtgctgcgttaacatgaacgtgtccatctacctcattggcctgatgagc
atcgaccgctggctagctgtcacaaaacccttcctgtctcagaagatgaggaccaaacaa
accctgaaggccgtgttgctgggaatctgggttctggccttcatcatggctctgcccatg
cctttctaccgcagtaacctgcaaatgaacagctctgtcaccatctgcgtgccttaccac
tggaacagcgtgggtcaccaggtgttccaatacctctttgagaccatcctttgcttcttc
ctccccttcaccttcatcacagtgtgctacggcactgtcctctgccgactgcgcgctgtc
atgctccaacgcaaaggacgggtgcagcggggacagcgcggaaaccgcctcatcatcctc
atcatcggagcgttcgctggctgctggctgccttaccacatcgtcaacatcttacaggtg
actggtctgctgagtggcaacaacagtctgatcaaagcagccttggtggcccgtccaaac
accacagctttcgccttcctgagtagcagcgtgaaccctctgctgtgtgtgctggccggg
agcccccatttccacaaggccggcctcagcttcattgctgagctcttcgagggcacgaac
cccgaaaggcggacgtccacctccttctctcgcagcacgaggaccagtcggagtagctcc
ttcgctccgggcgacagctttgctatgcgcaagctgtcattcaagcccggtcggaaggtg
aagggcaaggatgaggatggggacgtcctagcggaaaggcagggagcgctgatcatggtt
aaggctaagtga

DBGET integrated database retrieval system