KEGG   Esox lucius (northern pike): 105008212
Entry
105008212         CDS       T04894                                 

Definition
(RefSeq) N-acyl-aromatic-L-amino acid amidohydrolase (carboxylate-forming) A
  KO
K18458  N-acyl-aromatic-L-amino acid amidohydrolase [EC:3.5.1.114]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105008212
Enzymes [BR:els01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.114  N-acyl-aromatic-L-amino acid amidohydrolase
     105008212
SSDB
Motif
Pfam: AstE_AspA RRM_1
Other DBs
NCBI-GeneID: 105008212
NCBI-ProteinID: XP_010865753
UniProt: A0A3P8Z5F1
AA seq 313 aa
MMDPVSLPPLSRIAICGGTHGNEMSGVHLVRELQRQKMEKVGSAALTTVISNPCAIQVCR
RYIDKDLNRCFTDAILSSPVTGDTPYEVRRAQELSALLGPKGSVQAMDLVCDLHNSTSNM
GLSLITYFNQDPLILHICRHIQRKVTLAPVRLIQLDTPHSDAYSLDSIGKHSFSIEVGPQ
PHGVIRADIFNIMKEAVDQTLEWVRCFNSGSAFEGAEVDNVYIFVKSVEYPRDPETNHVT
AVIHPQLQDRDFCLLRPGDPMFLTFSGDTVKYEGEEVLHPFFVNEGAYYEKNIAFHLGRR
ITLTIPSLQMKGH
NT seq 942 nt   +upstreamnt  +downstreamnt
atgatggatccagtctctctcccaccactgtcccgcattgccatctgtggcggtacccat
ggaaacgagatgtcgggcgtgcacctggtgagggagctgcagaggcagaagatggagaag
gtggggtcagccgccttgaccacggtcatatccaatccgtgtgccatccaagtgtgcaga
agatacatcgacaaggacctcaaccgctgtttcacggatgccatacttagttcacctgtg
acaggtgacaccccgtatgaggtgaggcgagcgcaggagctcagcgctctgctcggtccc
aagggcagtgttcaggccatggacctggtgtgtgacctccacaactctacatccaacatg
ggcctcagtctcattacctacttcaaccaagacccgctcatcttacacatctgcagacat
atccagaggaaggtaacattggcgcccgtgaggttgatccagctggacacccctcacagt
gacgcctactctcttgactccattggcaagcacagtttctcaatagaggtggggcctcaa
ccccatggggtcatcagagctgacatctttaacatcatgaaggaggccgtcgaccagaca
ctagaatgggtcaggtgtttcaactcaggaagtgcctttgaaggtgccgaggtggacaac
gtatacatcttcgtgaaaagcgttgaatacccgagggacccagagaccaatcacgtcact
gctgttatacatcctcaactgcaggaccgagacttctgtctcctacgtccgggagatccc
atgttcctgacattttctggggacacagtgaagtacgaaggagaagaagtcctccatccc
ttctttgtgaatgagggtgcatactatgagaagaacattgccttccacctgggacgtagg
ataacactcaccatccccagcttgcaaatgaagggacactga

DBGET integrated database retrieval system