KEGG   Esox lucius (northern pike): 105010309Help
Entry
105010309         CDS       T04894                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit-like isoform X1
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04260  Cardiac muscle contraction
els04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105010309
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105010309
   04261 Adrenergic signaling in cardiomyocytes
    105010309
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105010309
Ion channels [BR:els04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   105010309
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 105010309
NCBI-ProteinID: XP_019900503
AA seq 360 aa AA seqDB search
MKFCNSGALMLVTTAGAFIAFSLMTIAVGTDYWLYSPGVCRSKTSIHDNETIHKNEEVMT
HSGLWRTCCLEDVQKDQVLLERGCPEDPAEPIRTGVFRGVCKEIDHFLEDADYEQDAAEY
LLRAVRASSLFPILSVFLLFLGGVCVAASEFHKSKHNVILSAGILFVSAGLSNIIGIIVY
ISANSGDPGQSDSKKSYSYGWSFYFGAMSFVLAEMVGVLTVHVFIERHRRLRTSGRPSLT
KPSLVHSASYYNRYNRYRRRSSYRGNMDTRYSLSTAGQLQPHDSSSAALSMSKVVAAGPA
GSEFTLYTLAPPKLPPPNSKTADAGSGVEVGRSNFLSPLMAMPDNKETLPSNTNRRTTPV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttgcaatagcggggcgttgatgctcgtgaccacggcgggagccttcatagca
tttagcctgatgaccatcgcggttggaacggattactggctttactcccccggcgtctgc
cgctccaagacctccatccacgacaatgagaccatccataaaaacgaagaggtgatgacg
cactccggcctgtggcgcacatgctgtctagaagatgttcagaaggatcaggtgttgttg
gagagaggctgtccagaagaccctgctgaacccatacgaacaggtgtattcagaggtgtg
tgtaaagaaatcgatcatttcctggaggatgcagactatgagcaggatgctgcagaatac
ctcctgagagcagtgcgcgcatccagcctcttccccatcctcagtgtgtttctcctcttt
ctcggaggagtgtgtgtggctgccagcgagttccacaagtcaaaacacaacgtcatcctc
agtgcagggatactattcgtgtctgcaggcctcagcaacatcatcggcatcatcgtctac
atctcggccaactcgggcgaccccggccagagtgacagtaagaagagctactcctacggc
tggtccttctacttcggcgccatgtccttcgtcctggctgagatggtgggcgtcctgacc
gtacacgtcttcatcgagcgccatcgccggctgcgtaccagtggaaggccgtccctcacc
aaaccttccctggtccactccgcctcctactacaaccgctacaaccgctaccggcgccgc
tccagttaccgcggcaacatggacacccgctactcgttgtcgacagcggggcagctgcaa
ccgcacgactcctcgtcggcggcactgtccatgtcgaaggtcgtggctgctggaccggcg
gggtcagagttcaccctgtacacgctggccccgcccaaactgcctccgcccaatagcaag
acagctgacgcaggaagtggggtagaggtcgggaggagcaactttctgtcgccactgatg
gccatgcccgacaacaaggagacattgcctagcaacactaaccggaggactacacctgtc
tga

DBGET integrated database retrieval system