KEGG   Esox lucius (northern pike): 105012931Help
Entry
105012931         CDS       T04894                                 

Definition
(RefSeq) aldehyde dehydrogenase, dimeric NADP-preferring-like isoform X2
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
els  Esox lucius (northern pike)
Pathway
els00010  Glycolysis / Gluconeogenesis
els00053  Ascorbate and aldarate metabolism
els00071  Fatty acid degradation
els00280  Valine, leucine and isoleucine degradation
els00310  Lysine degradation
els00330  Arginine and proline metabolism
els00340  Histidine metabolism
els00380  Tryptophan metabolism
els00410  beta-Alanine metabolism
els00561  Glycerolipid metabolism
els00620  Pyruvate metabolism
els01100  Metabolic pathways
Module
els_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    105012931
   00053 Ascorbate and aldarate metabolism
    105012931
   00620 Pyruvate metabolism
    105012931
  09103 Lipid metabolism
   00071 Fatty acid degradation
    105012931
   00561 Glycerolipid metabolism
    105012931
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    105012931
   00310 Lysine degradation
    105012931
   00330 Arginine and proline metabolism
    105012931
   00340 Histidine metabolism
    105012931
   00380 Tryptophan metabolism
    105012931
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    105012931
Enzymes [BR:els01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     105012931
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 105012931
NCBI-ProteinID: XP_010873627
AA seq 507 aa AA seqDB search
MEKQAVQRAKEAFVTGRSRPLEFRVQQLKSLLRMITDRQGEIATALKQDINRSQYDTSLF
ELIGLENEINLAVSKLAQWAAPRPVERSLLTISDEVYIQPEPLGVVLIIGAWNYPWALTL
QPLVGAIAAGNAAVIKPSELSEYSASLLKSLLPRYLDQELYPVVCGGVSETQELLRQRFD
HVFYTGNSTVGRLVMEAAARHLTPVTLELGGKSPCYIDKNVDLRVACRRITWGKFVNCGQ
TCIAPDYILCEPSIQNRLVEGIRQTLLEFYGPDPKSSPDYGRIINQRHFNRVMALLEGYT
AAVGGQSDASQRYIAPTVVKDVPPHARLMQEEIFGPVLPIVTVSDVDDAIHFINEREKPL
ALYVFSSNKKVIKRMLAETTSGGVTVNDVMMQYTLSSLPFGGVGQSGTGMYHGKHTFDLF
SHLRACLVKSLGMEDVNMARYPPQNRQKARRVRLVLRTPLVDLSRRTYVWAVSATFVAFG
LFVTLTAILLIAGGLNCTCWRLWQIWR
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atggagaagcaggcggtgcaacgtgccaaggaggccttcgttactgggaggtcgcgaccc
ttggagtttcgagttcagcagctgaaatctctcctgagaatgatcacagacagacagggc
gagattgccaccgcactcaaacaggacattaacaggagccagtatgacacgtcgctgttt
gagctgataggtttggagaatgagatcaacctggctgtgtcaaagctggcccagtgggct
gccccccggcctgttgagagaagtctcctcaccatttcagacgaggtatacatccaaccg
gaacctttgggagtggtgctcatcattggagcctggaactacccctgggctctcactcta
cagcccctagttggggccatcgcagcaggcaacgcagctgttataaagccgtctgagctg
agcgaatactctgctagtcttctcaaatctctactcccacgatatctggaccaggagctg
taccctgtagtctgtggaggcgtctcggagacccaggagttgctgcgtcagcggttcgac
cacgtcttctacacggggaacagcaccgtgggtagactggtgatggaggccgccgcccgg
cacctcacccccgtcacgctggagcttggtgggaagagcccctgttacatcgacaagaac
gtcgacctcagagtcgcctgtcggcgcatcacatgggggaagtttgtgaactgtggtcag
acttgcatcgccccagactacatcctgtgtgagccgagcatccagaacagactggtggag
ggcatccggcagacccttctggagttttacggacccgacccaaaatcttcgcctgactat
ggccgcatcatcaaccagcgccatttcaaccgtgtgatggctctactggaaggatacact
gctgcagtaggcgggcagagtgatgcgtcacagcgctacattgctcccacagtggttaag
gacgtgcctcctcacgccaggctcatgcaggaggagatcttcggccctgtgttgcccatt
gtgaccgtcagcgacgtcgatgacgccattcacttcatcaatgagagagagaagcctctg
gctctctatgtcttctcctccaacaagaaggtaataaagcgaatgctggccgagaccacc
agtggaggggtgaccgtcaatgatgttatgatgcaatacactctcagctcgttgcccttt
ggaggtgtaggtcagagtggaacaggcatgtatcatgggaagcacacgtttgacctgttc
agccatctgagggcgtgtctggtcaagtccctgggcatggaggatgtcaacatggcacgg
tacccaccccagaaccgtcagaaagcccgcagggtcaggctggtcttgagaaccccgctg
gttgacctctccaggagaacctacgtctgggccgtctcagccacctttgttgcttttggc
ctctttgtgaccctgaccgcaatccttcttatcgctgggggtctgaactgcacctgctgg
cgactctggcagatttggcgctag

DBGET integrated database retrieval system