KEGG   Esox lucius (northern pike): 105013312Help
Entry
105013312         CDS       T04894                                 

Gene name
abhd6
Definition
(RefSeq) monoacylglycerol lipase ABHD6
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:els01002]
    105013312 (abhd6)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     105013312 (abhd6)
Peptidases [BR:els01002]
 Serine Peptidases
  Family S33
   105013312 (abhd6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase DUF2048 Ndr Thioesterase DLH Lipase
Motif
Other DBs
NCBI-GeneID: 105013312
NCBI-ProteinID: XP_012991858
AA seq 346 aa AA seqDB search
MDVDMTNMFVLAGGTLAIPILAFFASFYMWPAAIIHVYNWYWRRRLGLQVDYLENRGYRF
CYSHRGKPGPGRPSILLLHGFSANKDMWLPMAKFLPKHQHLLCVDMPGHEGTSRTDTSDY
TIEGQVKRIRQFVESVRLTRRPFHLVGTSMGGNVAGVYAARYPKDLCSVTLISPAGLPNE
SRFAKCLLEMEKEQQLGSSLEPQSIPLIPSTPEEMEEMLKLCSFVRFKIPQQILQGLVDV
RVPNNDFYRELFMEVVGEKSRYSLQENMHLITAPTQVIWGKQDQVVDVQGASLLAEGVSH
CQVELLDNCGHSVAMERPRKAAQLIMDFINNKYNASSGSNNHKKLS
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atggatgtagacatgacaaacatgtttgtcctggctggagggactctggcaatcccaatc
ctggccttctttgcctcattttacatgtggcctgcagctattatccatgtttacaactgg
tactggcgccggcgtctgggcctgcaggtggactacttagaaaatcgaggttaccggttc
tgttactcccaccggggaaagcccggtccaggccggccctccatccttctgctgcatggc
ttctctgctaacaaggatatgtggctgcctatggctaagttcctgcctaagcaccagcac
ctgctctgtgtggacatgccaggccatgaaggcacctcacggaccgacacctcagactat
accatagagggccaggtcaagaggattcgccagtttgtggagagtgtccgtctgaccagg
aggccgtttcacctggtggggacgtccatgggagggaatgtggccggggtctatgctgcc
cgctatcccaaggacctctgcagtgtcacactcatctccccagcaggtcttcctaacgag
agtcgttttgcgaagtgtctgttggagatggagaaagagcagcagttgggcagtagcctc
gaaccccagagcatccctctgatcccctccacccctgaggagatggaggagatgctcaaa
ctctgctccttcgtacgctttaagatcccacaacagattcttcagggattagttgatgtt
cgagttccaaacaatgacttctatagagagttgttcatggaggttgtaggagagaagtcc
agatactccttacaagagaacatgcatctgatcacggccccaacacaggtcatctggggg
aagcaagaccaggtggtggatgtccagggagcgtccctgctagcggagggggtgtcgcac
tgccaggtggagttgctggacaactgtggtcactctgtggcgatggagagaccccgcaag
gccgctcagctcatcatggacttcatcaacaacaaatacaacgctagctctgggtcgaac
aaccacaagaaactctcctga

DBGET integrated database retrieval system