KEGG   Esox lucius (northern pike): 105013930Help
Entry
105013930         CDS       T04894                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
els  Esox lucius (northern pike)
Pathway
els04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    105013930
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:els04040]
    105013930
Ion channels [BR:els04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   105013930
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD
Motif
Other DBs
NCBI-GeneID: 105013930
NCBI-ProteinID: XP_019907096
AA seq 572 aa AA seqDB search
MMTTNVWVKQEWNDYKLRWNPEEYENVTSIRIPSEFIWRPDIVLYNNADGDFAVTHLTKA
HLFYDGRIKWMPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDRAKIDLISMASDVDQM
DYWESGEWVIVNAVGKYNTKKYECCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLT
VLVFYLPSQCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSI
IITVFVLNVHHRSPRTHGMPQWVRRIFLDLVPRLLFMKRPPAMAKENCRQLIEMLHRTSS
TTAASQLQTFWDGMLGQQDHTLPNTTSDSPNILAFSSLTSPPPPQGIFLEAPNHFCHSLS
SQYSILMEEAPKPTAYSVSASPGSSTPSSSTSSPSLPLGPLGPLRSLPQDEPRTLVRNGR
SHGLEKACDGTRQNQVCHQRAQHHCQSNRFKYRCVHEEGGGAPVAGTGIGERRLKRQALL
ERLIGASFTEPSLDLETQETMVPTISPSLRSAIEGIQYIADHLRAEDADFSVKEDWKYVA
MVIDRIFLWMFVLVCILGTVGLFLPPWLAGMI
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atgatgacgactaatgtctgggtgaaacaagaatggaatgattataagctccgctggaac
ccagaggagtatgaaaacgtcacctccattcgcatcccgtctgaattcatctggaggcct
gacattgtactttataataatgctgatggtgacttcgcagtgacccacttgaccaaagcc
cacctgttctatgacgggcgcatcaagtggatgccgccagccatctacaaatcctcctgc
agcatcgacgtcaccttcttccccttcgaccagcagaactgcaagatgaagtttggctct
tggacttatgaccgtgcaaagatcgacttgatcagcatggctagtgacgtggaccaaatg
gactactgggagagtggtgagtgggtgatcgtcaacgctgtgggcaagtacaacaccaag
aagtatgaatgctgcactgagatctaccccgacatcacctactacttcatcatccgcagg
ctgcctctcttctacaccattaacctgataataccctgtctgttgatttcctgtctgact
gtgttggtcttctacctgccttcccaatgtggcgagaagatcacactgtgtatctccgtg
ctgctgtccctcaccgtcttcctcttgctcatcaccgagatcatcccgtccacctcgctg
gtcatcccgctgataggcgagtacctcctcttcaccatgatctttgtcaccctctccatc
atcatcactgtcttcgtgctcaatgtgcaccaccgctcgccacgcactcacggcatgcca
caatgggtgcggcggatcttcctggacctggtgccccgcctgctcttcatgaagcgcccc
ccggccatggctaaggaaaactgtcggcagctgattgagatgctgcataggactagctcc
acgacagcagccagtcagttgcagactttctgggatgggatgctaggacagcaggaccac
acgcttcccaataccacctctgacagtcccaacattctggccttctcctctttaacctcc
ccgcctccacctcagggcatcttcttagaggcccccaatcatttctgccactccttatcc
agccagtactccattctgatggaagaagctcccaagcccactgcatactctgtgtccgcc
tcacccggctcctccaccccatcgtcctccacctcttccccgtctctacctctgggtcca
ttagggcccctccgctctctgccccaggatgagccacggactcttgtccgcaatgggcgg
agccacggtttagagaaagcatgcgatggcacaagacagaaccaggtttgccaccagcgg
gcccagcaccactgccagtccaacaggttcaagtaccgctgtgtgcacgaggaggggggt
ggggctcctgttgctggcacaggaataggtgaaagaaggctaaagagacaggccctgcta
gagcgcctcattggagcctctttcacagagccctccttggatttggagacccaggaaacc
atggtgcccacaatatccccgtctctgagaagtgcaatagagggcatacagtacatcgct
gaccacctcagggcagaggacgctgacttctctgtaaaggaggattggaagtatgtggca
atggtcattgataggatatttctctggatgtttgtactggtgtgtatattaggaacagtg
gggctattccttcctccttggttggctggaatgatctag

DBGET integrated database retrieval system