KEGG   Esox lucius (northern pike): 105014021Help
Entry
105014021         CDS       T04894                                 

Definition
(RefSeq) T-box-containing protein TBX6L
  KO
K10180  T-box protein 6
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:els03000]
    105014021
   03019 Messenger RNA biogenesis [BR:els03019]
    105014021
Transcription factors [BR:els03000]
 Eukaryotic type
  Other transcription factors
   T-box
    105014021
Messenger RNA biogenesis [BR:els03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     105014021
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: T-box
Motif
Other DBs
NCBI-GeneID: 105014021
NCBI-ProteinID: XP_010874267
AA seq 468 aa AA seqDB search
MHSIRDMKPNFSSPPPSSVPGGLDAYHQGNIRMTLESPELWKSFHEIGTEMIITKPGRRM
FPHCKINISGLIPCSKYILLVDMVPVDGFRYKWNKEKWEVAGKAEPQPPCRTYLHPDSPA
PGSHWMKQSVSFLKLKLTNNTLDQHGHIILHSMHRYHPRFHIVQADDLYSVRWSVFQTFT
FPETSFTSVTAYQNTKITKLKIDHNPFAKGFRDVETNTKRRANRNPACPEKKAKKPDYLS
RESDEDSPPGFRRSSYEGYEGEQAELPKRKEEDVVKEERFSPWGSEREHGHHIQTDSSPG
PEPRDMYNAEQLVPAPASYQPFRFHEYGKSPSPSSSIGSSNGGSGQAIFESRVPDVATVP
EHEATKPSAHDIGQSPCGPQPPAGLHQDYTGVINMAMAQASKPGVLSHHIYTPYSTEQTL
GQWSTPGPAQYPPPHHLPNDYSTPAVHHGYHHGNVEWSQYPLFSYSCW
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcactccatcagagatatgaagcccaactttagttctccaccgccatcctctgttcct
ggtggccttgacgcctatcaccaaggcaacatccgaatgactttggagagccctgagctc
tggaagtcctttcatgaaatagggacagagatgattatcactaaacctggcaggagaatg
tttccacactgtaaaattaacatttctggactaattccatgttcaaagtacatcttgttg
gttgacatggtacctgtggatggtttcaggtataagtggaataaagagaaatgggaagtg
gctgggaaggctgagccgcagcccccatgccgaacatacctgcatccagactctccggcc
cctgggagccactggatgaaacagtcggtgtccttcctcaaactcaagctcactaacaac
actctggaccaacatggccatataattttgcattcaatgcaccgttaccacccacgcttc
cacattgtccaggcagatgacctgtacagtgtacgctggagtgtcttccagacctttact
ttcccagagacctcctttacctctgtcactgcttaccagaacactaagataaccaagctg
aaaattgatcacaacccatttgcaaaaggcttcagagatgtagaaactaatacaaaaagg
cgtgctaacagaaacccagcatgcccagagaagaaagcaaagaaaccggattatttaagc
agagagtctgatgaggacagccctccaggattccgcaggtcatcatatgagggatatgaa
ggagagcaggcagagctccctaaaagaaaagaggaggatgtggtgaaagaggagcgcttc
tccccctgggggtctgaaagggagcatggccaccacatccagacagactcatcccctggg
cccgaacccagggacatgtacaatgcagagcagttagtacctgcaccagcttcatatcag
cctttcaggttccatgaatatgggaagtctccatctccatcctccagcattggcagcagc
aatgggggatctggccaggccatctttgagtccagagtccctgatgtagctacagtccca
gagcatgaggccactaagccctctgctcatgacattggacaatctccctgtggcccccaa
ccccctgcagggctccatcaggactacacgggggttatcaacatggccatggcccaagca
agcaagccaggtgtcctcagccaccacatctacactccatacagcacagagcagacgttg
ggccagtggagcacccccggccctgcccagtatcctccccctcaccacctgccaaatgac
tacagtactccggctgtgcaccatggatatcatcatggcaacgtggagtggagccagtac
ccactcttctcctactcatgctggtga

DBGET integrated database retrieval system