KEGG   Esox lucius (northern pike): 105014071Help
Entry
105014071         CDS       T04894                                 

Gene name
ppil3
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase-like 3
  KO
K12734  peptidyl-prolyl cis-trans isomerase-like 3 [EC:5.2.1.8]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:els03041]
    105014071 (ppil3)
   03110 Chaperones and folding catalysts [BR:els03110]
    105014071 (ppil3)
Enzymes [BR:els01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     105014071 (ppil3)
Spliceosome [BR:els03041]
 Complex C
  Other components
   PPlases
    105014071 (ppil3)
Chaperones and folding catalysts [BR:els03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    105014071 (ppil3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 105014071
NCBI-ProteinID: NP_001290709
UniProt: C1BXN0
AA seq 161 aa AA seqDB search
MAVTLHTDLGDIKIELFCERAPKSCENFLALSAGGFYNSCIFHRNIKGFMVQTGDPTGTG
KGGTSIWGRKFEDEFSEHLKHNVRGVVSMANNGPNTNASQFFFTYAKQPHLDMKYTVFGK
LIDGFETLDELEKLPVNEKSFRPLTECHIKDVTIHANPFAG
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggcagtgacgcttcacacagatcttggggatataaaaatcgagctgttctgtgagcgt
gccccgaaatcatgtgagaacttcctagcgctgtctgccggtggtttctacaacagctgc
atattccacaggaacatcaaaggcttcatggttcagactggagaccccacaggcactgga
aaaggggggacaagtatatgggggaggaagttcgaagatgagtttagtgaacacctaaaa
cataatgtgcgaggtgtggtttccatggcaaacaatggtcccaacaccaacgcctcccag
ttctttttcacctacgccaagcagccccatctggacatgaagtacacagtgtttggaaag
ttaatagatggctttgaaacactggatgaactggagaagctcccagtcaatgagaagtct
tttcgaccactgactgagtgccatataaaggatgtgacgatacatgcaaacccatttgca
ggatag

DBGET integrated database retrieval system