KEGG   Esox lucius (northern pike): 105014109
Entry
105014109         CDS       T04894                                 

Gene name
aopep
Definition
(RefSeq) aminopeptidase O isoform X4
  KO
K09606  aminopeptidase O [EC:3.4.11.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:els01002]
    105014109 (aopep)
Enzymes [BR:els01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     105014109 (aopep)
Peptidases and inhibitors [BR:els01002]
 Metallo peptidases
  Family M1
   105014109 (aopep)
SSDB
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_M61 Arg_decarb_HB
Other DBs
NCBI-GeneID: 105014109
NCBI-ProteinID: XP_010874440
AA seq 811 aa
MGDDVNPDRDDLPLRANTSHILVRHYVLDLDIHFHTQVITGTLVLFLEPGPGAGEGAWAG
EGPGAGEGDLYTAQPSKTADSWEDESNGDFTLVLDCCDLAVSKVEELDVASVLDLQGLLE
EVRGEESVVEPQPGSQSAVLIQRLISLPATQWKKQHHLYSQCSRAPASESGRPLVFHTDR
WSLQVRHRGTRTPQEFPRALRICYETKPEGGSVRWTKDQDNRSCVYTAGSPINNRALFPC
QEPPVAMSTWQARVRAPRGCVVLLSGENQAEPTHLQETGLCSWDYYVTMPMPASTFTLAV
GSWSLVPTAQQTALFGTPHSHTGSLDLPFAASPQFMFERSALKDEKHFESGCTVSGENNV
SCCHVDYPCRFTEASAWSQRIIPHRVFAPPSLVPKAQFQILPLLPRCLAAAHATLGVHPF
PRLDILIVPAGFSSLGMASPHIIFLSQSVLCGERDGVGGVQPGLSLCGSRLCHELSHSWF
GLAIGARDWTEEWISEGFATYLEDVIWARAQQLSRTETDEQSKLKALLRWRRLSEELQNS
EDQLQILRPNMESTGQVSESGSSFVKHALNPEKNFMQVHYLKGYFLLRFLASKVEDERFL
SFFKLFVMKYHGQLILSQDFLQMLLETFPDKERQGLTLEAIHADWLDRPGIPKWLFEGSA
AWTQTRLVEEVKAEVVKWIGLNQSVGRGRKRKRARPKVTPEQLVLLLELLLEEAELSVTS
LCTIQRTYNLQEQDAEVRHRWCELVVKHKHTEAYHDVEHFLQHDQAMGVYLYGELMVHED
ARQQALARHCLSLLQDEMDQSARRVVEEMVL
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgggtgatgatgtgaacccagacagagacgatctgcccctcagagccaacaccagccac
attctggtcagacactatgtcctggacctggacatacacttccacacgcaggttatcact
ggtactctggtgctgttcctggagcctggccctggggctggagaaggagcttgggctggg
gaaggacctggggctggggaaggtgatctatacactgcccaaccatctaagactgctgac
tcctgggaggacgagagtaacggagacttcaccttagttctggactgctgtgaccttgct
gtgtcaaaggttgaggagctggatgtggcatctgtcttggacctgcagggtctcctagaa
gaggtcaggggcgaggagtcggtggtggaaccacaaccaggcagccaatcagctgtgctc
attcagaggctgatatcccttcctgccacccagtggaaaaagcaacatcacctgtactct
cagtgcagtcgtgcccctgcttctgagagtgggagaccccttgtcttccacactgatcgt
tggagcctgcaagtgcggcatagggggactcggacgccccaggagttcccccgagccctg
cgaatctgctatgagaccaagccagagggaggctctgtcaggtggactaaagaccaggac
aacaggtcgtgtgtttacactgccggctcgcccatcaacaaccgggccctctttccctgc
caggagcctcctgttgccatgtctacgtggcaggcccgggtgcgagcccccagggggtgt
gtagttctgttgagtggagagaaccaggccgagcccactcacctgcaggaaacaggtctt
tgtagctgggactactatgtcacaatgcctatgcctgcctccacctttactttggcagtg
ggtagctggagcctcgtccccacagcacagcagacagccctgtttgggaccccccattca
cacactggcagcttggaccttccatttgccgccagcccacagtttatgtttgagcgatcg
gccctaaaagacgagaagcactttgagagcggctgcacggtctcgggggaaaataacgtc
tcctgttgccacgttgattatccgtgccgattcacagaggcatccgcctggagccagcgg
atcatccctcaccgggtgtttgcccccccctctctggtgccgaaggcccagttccagatc
ctccctctgctgcctcgctgtctggctgctgcccacgccaccctgggtgtccaccccttc
cctcgcctcgacatcctcatcgtcccggcaggcttctccagcctgggcatggccagcccc
cacatcatattcctgtcccagagtgtgctgtgcggagagagggatggagttggaggagta
cagccgggcctgtctctgtgcgggtctcgtctgtgccatgagctctcccactcgtggttt
ggcctggccatcggggcccgggactggactgaggagtggatcagtgagggattcgccacc
tacttggaagatgtgatctgggcccgggcacagcagttgtccagaactgagacagacgag
cagtctaaactcaaggcattgctgaggtggaggaggctctccgaggaactacaaaactca
gaggatcagctgcaaatcctcaggcccaacatggaaagcacaggccaggtcagtgagtct
gggtcatcctttgtcaaacatgctctcaaccctgagaaaaacttcatgcaagttcactac
ctcaagggctacttcctcctcaggttcctggccagcaaagtagaagatgaaaggttcctc
agtttcttcaaactctttgtaatgaaataccatggacaactcattctctctcaggatttc
ttgcaaatgctgctggagaccttccctgacaaagagagacaaggcctcacccttgaagct
attcatgccgactggctggatcgaccaggaattcctaagtggttgtttgaagggagtgcc
gcgtggacacagactcggctggtggaagaagtcaaagcggaggtagtaaaatggattggt
ctcaatcagagcgttggaaggggcagaaagcggaagagagcaagacccaaggtgactccg
gagcagctggtgttgctattggagcttcttctggaggaggcggaactaagtgtgacatcg
ctgtgtacgattcagagaacgtacaatctacaggagcaggacgccgaagtgaggcaccgc
tggtgtgagttggtggtcaaacacaagcacactgaggcgtaccacgatgtggaacacttc
ctccaacacgaccaggccatgggtgtgtatctgtacggtgaattaatggttcatgaggat
gctaggcagcaggcgctagccaggcactgcctctcattactccaggatgagatggaccaa
tcagctcgcagagtggtggaggagatggtcctatga

DBGET integrated database retrieval system