KEGG   Esox lucius (northern pike): 105014159Help
Entry
105014159         CDS       T04894                                 

Definition
(RefSeq) tumor necrosis factor
  KO
K04389  tumor necrosis factor ligand superfamily member 6
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
els04060  Cytokine-cytokine receptor interaction
els04068  FoxO signaling pathway
els04210  Apoptosis
els04217  Necroptosis
els05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105014159
   04068 FoxO signaling pathway
    105014159
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105014159
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105014159
   04217 Necroptosis
    105014159
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    105014159
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:els04147]
    105014159
   04052 Cytokines and growth factors [BR:els04052]
    105014159
   04090 CD molecules [BR:els04090]
    105014159
Exosome [BR:els04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   105014159
Cytokines and growth factors [BR:els04052]
 Cytokines
  Tumor necrosis fators
   105014159
CD molecules [BR:els04090]
 Proteins
  105014159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TNF DUF2125
Motif
Other DBs
NCBI-GeneID: 105014159
NCBI-ProteinID: XP_010874517
AA seq 248 aa AA seqDB search
MTEEVCCEMIPDRRAEFYYSRERGRDHVRPGRLTQFAVVVSLTLSCAALLLNQLQHKAAN
NQHVSGGAETTGVQNLLGNESALSPSDSEQQQHAATIPSAHLTAPRSFNNSKREYLEWED
HFGHVHLSEFKYHDGDLIVPRDGIYKVYLQITFRRPGNFQCDTDVFILTQKVLLYAANYP
ENVDLLAASDIVYCMPNSEEMPYWEKSPNTSGVFKLNAGDKLRVKNGNRFHELMLLQEDK
TFFGAHLI
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagaggtttgctgtgagatgatccctgaccgtcgtgcggagttttactacagt
cgggagaggggcagagaccatgtgcggccaggtcgcctcactcagtttgcagtggtggtc
tctctaacgctgtcttgtgctgcactcttgctaaaccaacttcagcataaagcagcgaac
aaccagcacgtgtcaggtggagcagaaactacgggtgttcaaaacttactgggcaatgaa
tctgctttatctccttctgattctgaacagcagcagcatgctgcaacaattccaagtgca
cacctgacagcaccccggtcatttaataattcaaaacgtgaatatctggagtgggaggac
cactttgggcatgttcacctcagtgaattcaagtatcatgacggtgatctcattgtcccc
cgtgacggcatctacaaagtttaccttcagatcactttcaggaggcctggtaactttcag
tgtgacactgatgtgtttatccttacccagaaggtactgctgtatgcagcaaactaccca
gaaaacgtagacctcctggcggcctcggatatagtgtactgcatgccaaactcagaggag
atgccatactgggaaaagtctcccaacacatctggagtgtttaaactgaacgccggagac
aagctcagagtgaagaacggaaacaggtttcatgagctgatgcttttgcaagaagataag
acattttttggagcacatctcatttga

DBGET integrated database retrieval system