KEGG   Esox lucius (northern pike): 105014193Help
Entry
105014193         CDS       T04894                                 

Gene name
mtmr3
Definition
(RefSeq) myotubularin-related protein 3 isoform X1
  KO
K18082  myotubularin-related protein 3/4 [EC:3.1.3.48 3.1.3.64 3.1.3.95]
Organism
els  Esox lucius (northern pike)
Pathway
els00562  Inositol phosphate metabolism
els01100  Metabolic pathways
els04070  Phosphatidylinositol signaling system
els04140  Autophagy - animal
Brite
KEGG Orthology (KO) [BR:els00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    105014193 (mtmr3)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    105014193 (mtmr3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    105014193 (mtmr3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105014193 (mtmr3)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     105014193 (mtmr3)
    3.1.3.64  phosphatidylinositol-3-phosphatase
     105014193 (mtmr3)
    3.1.3.95  phosphatidylinositol-3,5-bisphosphate 3-phosphatase
     105014193 (mtmr3)
Protein phosphatases and associated proteins [BR:els01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Myotubularins
    105014193 (mtmr3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myotub-related FYVE Y_phosphatase3 Y_phosphatase DSPc BNIP3
Motif
Other DBs
NCBI-GeneID: 105014193
NCBI-ProteinID: XP_010874589
AA seq 1309 aa AA seqDB search
MEEEGQQSMECIQAVQNFPRKPPVLEEENLQVPFPELHGEFTQYVGRAEDAIIAMSSYRL
HIKFKESIVNSDSCEVSVPLQLIETVECRDMFQLHVTCKDCKVVRCQFSTFEQCQEWLKR
LNAAARPPARLEDLFSFAYHAWCLNSFTGELCRPGTLTADDSRGDSGPRPASSHVSGSLS
APLGEHVTSWFKNEVERMGFDTHNAWRITDINNKFRLCSSYPQQLLVPAWITDKELENVA
AFRSWKRFPAVVFRHQSTGAVIARCGQPEVSWWGWRNADDEHLVQSIAKACAVDGSSRKH
LANGSYTNGTNGIHGANELADTDFESSLTNGSEVETLAIQPQKLLILDARSYAAAVANRA
KGGGCECPEYYPNCEVVFMGMANIHSIRKSFQSLRFLCTQMPDPANWLSALESTKWLQHL
SLLLKAALLVVNAVDRDHRPVLVHCSDGWDRTPQIAALSKLLLDPYYRTIEGFQVLVETE
WLDFGHKFADRCGHGENSEDLNERCPVFLQWLDCVHQLQRQFPCSFEFNEAFLVKMVQHS
YSCLFGTFLCNSGKEREERNIREKTCSVWSLLRPANRTLTNMLYSSRSETVLHPVCHVRN
LMLWTAVYLPSSSPTTPSDESCAPYPVPGANPEEAPLGRRPKTRSFDNLPSACELGSSLA
PNRRSSDPSLNEKWQDHRRSLELNMTVGPDGGGAQDHDGRTNGQPGATGPQAAASQVELG
DHLQGSWAQAEGTSEDQRTDLGDGGSEGSLAAGEEIERSVELSVAVAEGQMENILQEATK
EEAGADVQREAAITPQMEANGTDMDKEVGAVETENAEQAIVNEAETRTEATLTNGHYPEK
GTEEPEEDSSVSPASPSLPNDVSKDLPEHPEAVAMPEQKRTEQVPVNWSECQKSNPGPSP
RAPPTLTNGFGERAPERPEAAESLVQADKRASLMESSTETLTEEVCPGPQPSAEARNQPL
CPRRVNGEAELEQGSSRTMNGGHKRSTVGAFRSLSAEPSREALCNGEGSELEPCGAPHWA
RVNGERAPLSRQVSLASCGSLTFHCRAGCSHHRCLHAPPGPLAATPSPEQPARSHLDDDG
LALHTDAVQQRLRQIEAGHQMEVETLKRQVQELWSRLESHHHAASLRINGDMGDEVTSMT
DSDYNLDANCLSRCSTELFSEASWEQVDKNDTEVTRWYPDHLAAQCYGCESRFWLATRKH
HCRLTLSRSPAVGTVGMCSVPAAATRRSRCRVSSCLSPPACVGPAMAPCTAPPPPVVPWT
WRNPSQPAPTRAGGGMGRGPARQALTVMHPADEHRSCRMSPVPVCVCVE
NT seq 3930 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggggcagcagagcatggaatgcatccaggccgttcagaactttcccagg
aagcccccagtcctggaggaggagaacctgcaggtgccctttccggagctgcacggggag
ttcacccagtatgttgggagagcagaggatgccatcattgccatgtccagctaccgcctc
cacatcaaattcaaagagtccatcgtcaatagtgacagttgtgaggtgtcagtccctctg
cagctcatcgagaccgtggagtgtcgcgacatgttccagctccacgtcacctgcaaggac
tgcaaagtcgtcaggtgtcagttctccaccttcgagcagtgtcaggagtggctgaaacgg
ctcaacgccgcggcccgccccccggcccgcctggaggacctcttctcctttgcgtaccac
gcctggtgtctcaactcatttaccggggagctgtgcaggccaggtacgctgacggcggac
gactcgcgtggtgactcgggccctcgtccggcctcctctcatgtctctgggtccctgtct
gccccgttaggagagcacgtgacctcctggttcaaaaacgaggtggagaggatgggcttt
gacacccacaacgcctggcggatcaccgacatcaacaacaagttcaggctgtgctccagc
tatccgcagcagctcctggtgccagcttggatcacggacaaggagctggagaacgtggcg
gccttccgctcctggaagagattcccagctgtggtgttcaggcaccagagcacaggggct
gtgatcgcccgctgcggccagcctgaggtcagctggtggggctggaggaatgccgacgac
gagcaccttgtccagtccatcgccaaggcctgtgctgtggacggaagctcgcggaaacac
ctggccaatgggtcctacaccaatggaaccaatgggatccacggcgccaacgagctcgca
gacactgactttgaatcctccttgacgaacggctctgaagtggagaccctggccatccag
ccgcagaagctgctgatcctggatgccaggtcctacgctgcagccgtggccaaccgggcc
aagggagggggctgtgaatgcccagagtactaccccaactgtgaggtggtgttcatgggc
atggctaacatccactccatccgcaagagtttccagtccctgcgcttcctctgcacccag
atgccggacccggccaactggctgtctgctctggagagcaccaagtggctgcagcatctg
tctctgctgcttaaggctgccctgctggtggtgaacgcggtggaccgcgaccaccgcccc
gtcctggtgcactgctctgacggatgggatcgcacgccccagattgccgccctgtccaag
ctcctgctggacccctactaccgcaccattgagggcttccaggttctggtagagactgag
tggctagattttggccataagttcgctgaccgctgtgggcacggggagaactcggaggac
ctgaacgagcgctgtccggtcttcctccagtggttggattgcgtgcaccagctgcagagg
cagttcccgtgctcctttgagttcaacgaggctttcctggtgaaaatggtgcaacactcc
tactcctgcctgtttggcaccttcctatgcaacagtggaaaggagagggaggagcggaac
attcgggagaagacctgctccgtgtggtctctgctgcggccagccaatcgcactttgacc
aacatgctctactcgtcccgctcggagaccgtgctccacccggtgtgtcacgtacgcaac
ctgatgctgtggacggctgtctacctgcccagctcctccccaaccacgccctccgacgag
tcgtgtgccccctatcctgtgccgggtgccaaccccgaggaggcgcctctgggcagacgt
ccaaagaccaggtcctttgataacttgccaagtgcatgtgagctggggagctcgctggcc
cctaaccgacgctccagtgaccccagcctgaatgagaagtggcaggaccaccggcgctct
ctggagctcaacatgactgtggggcccgacggagggggagctcaggaccacgacgggcgg
accaacggccagcctggagctaccgggcctcaggcagctgcgtcccaagtcgagctgggg
gaccacctccaaggttcctgggcccaggcggagggcacttctgaagaccagcggaccgac
ctgggtgacggaggctcagaggggtcgctagcggcaggagaagagatcgagcgctccgtt
gagctgtctgtggctgtagccgagggacagatggagaacattcttcaggaggcgacgaag
gaggaagctggtgccgacgttcaaagggaggctgccatcacgccgcagatggaggctaat
ggaacagacatggacaaagaggtcggtgccgttgagactgagaacgctgaacaggccatt
gtcaatgaggctgagacccggacagaggctactctcaccaatggacactacccagagaaa
ggcaccgaagagcctgaagaggattctagtgtctccccagccagtccctccctgcctaac
gatgtgtccaaagaccttcctgagcacccggaggctgtggcgatgccagaacagaagcga
acagaacaggttccagtgaactggagtgagtgccagaagtctaaccccggcccgtccccc
cgggcccctccgactctgaccaatggttttggggagagggctccggagaggccagaggcg
gcagagtccctggtgcaagctgacaagagggcctcgctcatggagagctccactgagact
ctgaccgaagaggtctgccccggcccccagcccagcgccgaagccaggaaccaacccctc
tgccccaggagagtgaacggggaggcggagctagaacaagggtcgtccaggactatgaac
ggaggacacaagcgctccaccgtcggtgccttccggtctctgagcgccgaacccagcagg
gaggctctgtgtaacggcgagggctctgagctggagccctgcggggccccccactgggcc
agggtgaacggggagcgggccccgctgagccgccaggtgtccctggcctcctgcggctcg
ttgaccttccactgccgggccggctgctcccaccaccgctgcctccacgccccgccgggc
cctctggccgccacgcccagcccagagcagcccgcccggagccacctggacgacgacggg
ctggcgctccacacggacgccgtccagcagcggctgaggcagatcgaggcgggccaccag
atggaggttgagacgctgaagaggcaggtgcaggagctgtggagtcgcctggagagccat
caccacgccgcctccctgcggattaacggggacatgggagatgaggtgacctcgatgaca
gactcggattacaacctggacgccaactgcctgtctcgctgcagcaccgagctcttctca
gaggcgagctgggagcaggtagacaagaacgacacagaggtgacccgctggtatccagac
cacttggcagcccaatgctatgggtgtgagagtaggttctggcttgccaccaggaagcat
cactgcagactgaccctgtctcggtctcccgctgtaggaactgtgggaatgtgttctgtg
ccagctgctgcgaccagaagatcccggtgccgagtcagcagctgtttgagcccacccgcg
tgtgtcggacctgctatggcaccctgcacagcaccaccacccccggtggttccgtggacc
tggaggaacccgtcgcagccagctccgactagggccgggggggggatgggccgggggccg
gcccgccaggctctgacagtcatgcaccctgctgacgagcacaggagctgcagaatgtcc
cctgtacctgtatgtgtgtgtgttgaataa

DBGET integrated database retrieval system