KEGG   Esox lucius (northern pike): 105014365Help
Entry
105014365         CDS       T04894                                 

Definition
(RefSeq) erlin-2 isoform X2
  KO
K23341  erlin
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:els04121]
    105014365
Ubiquitin system [BR:els04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   ERAD complex
    105014365
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7
Motif
Other DBs
NCBI-GeneID: 105014365
NCBI-ProteinID: XP_010874935
AA seq 342 aa AA seqDB search
MAFNEVSTVTTVMAQLGAIASIICAIGGASLFASVHKIEEGHTGVYYRGGALLTTTSSPG
FHLMMPFITSFKSVQTTLQTDEVKNVPCGTSGGVMIYFDRIEVVNYLVPSAVYDIVRNFT
ADYDKALIFNKVHHELNQFCSVHSLQEVYIGLFDQIDENLKLTLQEDLTNMAPGLIIQAV
RVTKPNIPESIRRNYEMMEAEKTKLLISAQTQKVVEKEAETERKRAVIEAEKVAQVAEIK
FSQKVMEKETEKKISEIEDTAFLAKMRARADAELYTAQRTAEANKLKLTPEYLQLMKFQA
IAANSKIYFGSEIPQMFVDSGPTSSKASAAMDVLAEQILDLD
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggcctttaacgaagtatcaacagtgacaacagtgatggcacagttgggtgccatagcc
tcaataatatgtgcaattggaggtgcatctctcttcgcctctgtgcacaagattgaggag
ggacatactggagtttactacagaggaggagctctccttaccaccaccagtagtcctggc
tttcacctcatgatgcccttcataacgagcttcaagtctgtacagaccacccttcagaca
gatgaagtgaagaatgtaccatgtggcaccagtggtggagtgatgatctactttgaccgg
atcgaagtggtgaactaccttgtaccatctgcagtgtatgatatagtgaggaacttcaca
gccgactatgacaaggccctgattttcaacaaggttcaccatgagctcaatcaattctgc
agcgtccactctctgcaggaggtctacatagggttgttcgatcagatcgatgagaatctg
aaactgaccttacaggaagatctaactaacatggctccaggactcatcatacaggctgtc
cgagtcaccaagccaaacatccctgagagcattcgcaggaactatgaaatgatggaggct
gagaagacaaagcttctgatttctgctcagactcagaaggtcgtagaaaaggaggccgag
acagagcggaagagagctgtgattgaggcagaaaaggttgctcaagtggctgaaataaag
tttagccagaaagtaatggagaaagaaaccgagaaaaagatctctgaaattgaagacaca
gcattcctggccaagatgagggcaagggctgatgcagagctctacacagcccagagaacg
gcagaggctaataagctcaagctgactccagaatatctgcagctgatgaagtttcaggcc
atagccgcaaacagtaagatctactttgggagtgagatcccacagatgtttgtagactcc
ggtcccacttccagtaaggcttctgctgccatggacgttctggcggaacagatcctggac
ctggactga

DBGET integrated database retrieval system