KEGG   Esox lucius (northern pike): 105014828
Entry
105014828         CDS       T04894                                 

Gene name
gpn3
Definition
(RefSeq) GPN-loop GTPase 3
  KO
K24104  GPN-loop GTPase
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105014828 (gpn3)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105014828 (gpn3)
SSDB
Motif
Pfam: ATP_bind_1 CLP1_P Gtr1_RagA AAA_30 RNA_helicase AAA_22 AAA_18 MMR_HSR1 DUF87 AAA_17 ATPase_2 AAA_19 MeaB FtsK_SpoIIIE AAA_14 AAA_7 AAA_10 ABC_tran T2SSE AAA_29 AAA_16 CbiA AAA_33 Viral_helicase1
Other DBs
NCBI-GeneID: 105014828
NCBI-ProteinID: NP_001290677
UniProt: C1BWL6
AA seq 285 aa
MPRYAQLVMGPAGSGKSTYCSTLIEHAEAINRSVQVVNLDPAAEHFNYPVMADIRELIMV
DDVMEDESLKFGPNGGLVFCMEYFANNFDWLEESLGHVEDDYILFDCPGQIELYTHLPVM
RQLVEQLQQWEFRVCGVFLVDSQFMVETFKFISGIMAALSAMVALEIPTVNIMTKMDLLS
PKAKKEIEKYLDPDMYSMMEDNSVSIRSKKFKKLTKAICGLIDDYSMVRFLPFDRTDEEG
INIVLQHIDFSIQYGEDLEFKEPKEPDEEPDNTNYDDFFRDKVEN
NT seq 858 nt   +upstreamnt  +downstreamnt
atgcctcgttacgctcaactggtgatgggcccggcgggaagtggaaagagtacctactgc
tctacactgattgagcatgcagaagccataaaccgctctgtacaggtggtcaacctagac
ccagctgctgaacactttaattacccggtcatggcagatatccgggagctgatcatggtg
gatgatgtgatggaggatgagtcgctgaagtttggcccaaatggagggcttgtcttctgc
atggagtactttgccaacaattttgactggctggaggaaagcctgggccacgtggaggat
gactacatactgtttgactgtcctggtcaaatcgagctgtacacacacctccctgtgatg
agacaactggttgaacagctccagcagtgggagttccgtgtttgtggtgtcttcttggtg
gactcacagttcatggtggagaccttcaagtttatctctggtataatggctgcattgagt
gccatggtggctttggagattccaacggtcaacatcatgaccaaaatggacctgttgagt
cccaaggccaagaaagaaattgagaaatacctggacccagacatgtactcaatgatggag
gacaattctgtctccattagaagcaagaagttcaagaagctgaccaaagccatctgtggt
ttgattgatgattacagcatggtgaggttcctgccttttgaccgcacagacgaagaaggc
atcaacatagtgcttcagcacattgacttctccatacaatacggagaagacttggagttc
aaggaaccaaaggagccagatgaggagccggacaacacaaattatgatgatttcttcagg
gacaaagtagagaactga

DBGET integrated database retrieval system