KEGG   Esox lucius (northern pike): 105015105Help
Entry
105015105         CDS       T04894                                 

Gene name
thnsl2
Definition
(RefSeq) threonine synthase-like 2 isoform X1
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    105015105 (thnsl2)
Enzymes [BR:els01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     105015105 (thnsl2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-GeneID: 105015105
NCBI-ProteinID: XP_010876268
AA seq 493 aa AA seqDB search
MLVMWYCSTRGGVQGWGFQEVLFSGYAPDGGMFMPETLPTLTPDTLRSWRSLSYPQLVIS
VCSVFIPTEVIPLADLEDLVNTALSGFSVPGAVSLAKLKQGLNVLELFHGKTMAFKDLAM
TCTVHFLNYFLHENSLRAIVVVGTSGDTGGSAIQSAKGLSGLDLVVVYPRGRITPVQEKQ
MTTCLEDNIHVFAADGSSDDVDVPIRRLFSDQELVKRHRLMSLNSVNWSRVMVQLAHFIY
AYLHVSGLEEAEIAAPLPVLEIIVPTGGAGNIAAGCIVKQMGIPLCLVAMTNANDIVPRT
VKSGDFSMATNVTQTLAPAIDIQDPYNMERVFWLLSGRDGGLVKRMMEEFQNLHRHTLPK
ALHKQLSQALTSGAVGDQEIVETMQRCWKENQYLLCPHTAVAVWHHYHCSPTAGVNRCCL
ATASPSKFQAAVQKAGLTLDLPEKVLALDKKQTRYVALDRSENWEKDWEGRLKQCIQAIG
SARQHGLSYYEHE
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgttagtaatgtggtactgcagcacccgtggtggagtccagggttggggttttcaggag
gtgctgttctccggctatgctcccgatggggggatgttcatgcctgagaccctccctacc
ctcacccctgacacactgaggtcctggaggtccctgtcctatccccagctggtgatatca
gtgtgctccgtgttcattcctacagaggtgatccctttagcagacttggaggacttggtg
aacacagccctgtctgggttctcagtgccgggggcagtgagtctggccaagctgaagcag
gggctgaatgtgttggagctcttccatggaaagaccatggccttcaaggaccttgccatg
acctgcactgtgcacttcctcaattacttcctgcacgaaaacagcctgcgtgccattgta
gtcgtaggcacatccggggacacgggtggttctgccattcagagtgcgaaaggcctcagt
gggctggacctggtggtggtgtacccccgaggccgtataacccccgtgcaggagaaacag
atgaccacatgcctggaggacaatatccatgtgtttgcagcagacggcagttctgatgac
gtcgatgtgccgatccgtcgactgttttccgaccaggagctcgtaaaacgccataggctg
atgagtctcaactcagtcaactggtctcgcgtcatggttcaattggcgcactttatttat
gcctacctgcatgtgagcgggctggaggaggcagagatagcggcgcccctgcccgtcctg
gagataatagttcccacaggaggggctgggaatatcgccgctggctgcattgtgaagcag
atggggataccgctgtgtctagttgctatgacgaacgctaatgatatagtgcccaggacg
gtgaagagcggcgacttctccatggcaactaatgtcacgcagaccttagccccagctata
gacattcaggacccctataacatggagcgtgttttctggcttctgtctggtagagatgga
ggcctagtgaagagaatgatggaggagtttcaaaacttgcatcgacacacgctgcctaaa
gctctccacaaacagctgtcccaagccctaacatcaggggcagtaggagatcaggagata
gtggagaccatgcagagatgctggaaggagaaccaatatctactgtgtccccacactgcc
gtggctgtttggcatcactatcactgttcccccactgcgggggtcaacaggtgttgccta
gcaacagcctctccttccaagttccaggctgcggtgcagaaggcagggctaacccttgac
cttcctgagaaagtgctggcccttgacaagaagcaaactcgttacgtggctctggatcga
agcgagaactgggagaaggactgggagggcagactgaagcaatgcatccaggctataggc
tctgccagacaacatggactgtcctactatgaacatgagtaa

DBGET integrated database retrieval system