KEGG   Esox lucius (northern pike): 105015321Help
Entry
105015321         CDS       T04894                                 

Gene name
dusp10
Definition
(RefSeq) dual specificity protein phosphatase 10
  KO
K20216  dual specificity phosphatase 10 [EC:3.1.3.16 3.1.3.48]
Organism
els  Esox lucius (northern pike)
Pathway
els04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:els00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    105015321 (dusp10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:els01009]
    105015321 (dusp10)
Enzymes [BR:els01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     105015321 (dusp10)
    3.1.3.48  protein-tyrosine-phosphatase
     105015321 (dusp10)
Protein phosphatases and associated proteins [BR:els01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   MAPK phosphatases
    105015321 (dusp10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Rhodanese PTPlike_phytase Y_phosphatase Init_tRNA_PT
Motif
Other DBs
NCBI-GeneID: 105015321
NCBI-ProteinID: XP_010876697
UniProt: A0A3P8YB10
AA seq 493 aa AA seqDB search
MPPTPLDDRIVVALPRPIRPQELRLRLDTSYLDAGVAIPDSETTVNGTTVVKIRATNLTF
MPSSNGSTRSLSCGCSSASCCSVTTYEKDSQLHQRHQQSPGSQVSASSPNLSYAGPASSA
SGQAVAGLVHHEAFSDPSLTSGPTEAPGSPVRVIHPNELARRLARCPMGHPVGPVPVIID
CRPFTEYNRSHIQGAVHINCSDKISRRRLQQGKITVLDLLSCRESPGRESFKGIFSKEIV
VYDENTMDPQRLTSSQPLHVVLDSLRREGKDPIVLKGGLSCFRQHHQSLCDHSLHLHESP
DAGTGVGGASGLTGALPHSMSLPSTPDIENAELTPILPFLYLGNERDAQDVHLLQRCNIG
YVLNVTTHLPLYHYDTGLFSYKRLPATDSNKQNLRQYFEEAFEFIEEAQQAGMGLLIHCQ
AGVSRSATIVIAYLMKHTWMTMTDAYKFVKTRRPVISPNLNFMGQLLEFEEDLNNGVTPR
ILTPKLMGVETAV
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaactcccctcgacgacagaattgtggtggcgctgccaaggccgatccgacct
caggaactccgactgcgcctggacaccagctacctggacgccggcgtcgccatccccgac
agcgagacgacggtcaacggtaccacggtggtgaagatccgggcgaccaacctcacgttt
atgccctcatccaacggatccacccgctccctgtcgtgtggatgcagcagtgccagctgc
tgctcggtgaccacctacgagaaggacagccagctccaccagcgccaccagcagagccca
gggagccaagtgagcgccagcagccccaacctcagctatgctggacccgcctcctctgcc
tctggccaggctgtcgccggcttggtccaccacgaggccttcagcgaccccagcctcacc
tcgggcccaactgaggctccggggtcccctgtccgggtcatccaccccaacgagctggcc
aggcggctggccaggtgccccatgggccacccggtcgggccggtgccggtcatcattgac
tgtcggcccttcacggagtacaacaggagccacattcagggcgccgtgcacatcaactgt
tcggacaagatcagccggcggcggctgcagcagggcaagatcacggtgctggacctgctg
tcgtgccgcgagtcccccggcagggagtccttcaagggcatcttctccaaggagattgtg
gtgtacgacgagaacaccatggatcctcagaggctgacctcctcgcagcctctacatgtg
gtcctggattctctgcggagggagggaaaggatccaattgtcctcaaaggaggcctcagc
tgcttccggcagcaccaccagagcctgtgcgaccactccctccacctccacgagagcccg
gacgccggcacgggtgtcggcggggcctccggcctcacgggggcgctacctcactccatg
tctctgccctccacgccggacatcgagaacgcagagctgacacccatcctgcccttcctg
tacctgggcaacgagcgcgacgcacaggacgtccacctgctgcagcgctgcaacatcggc
tacgttctcaacgtcaccacccacctgcctctctaccattacgacaccggactgttcagc
tacaagcggctgccggccactgacagcaacaagcagaacctgcggcagtactttgaggag
gcgttcgaattcatcgaggaagcccagcaggcgggcatgggcctcttgatccactgccag
gctggcgtgtcgcgctctgccaccatcgtcatcgcctacctgatgaagcacacctggatg
accatgacggacgcctacaagtttgtcaagacacggcggccggtcatctcgcccaacctg
aacttcatgggccagctactggagttcgaggaggacctgaacaacggcgtcacgccgcgc
atcctcacgccgaaactcatgggggtggagaccgcggtttag

DBGET integrated database retrieval system