KEGG   Esox lucius (northern pike): 105015462
Entry
105015462         CDS       T04894                                 

Gene name
gpn1
Definition
(RefSeq) GPN-loop GTPase 1
  KO
K24104  GPN-loop GTPase
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105015462 (gpn1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105015462 (gpn1)
SSDB
Motif
Pfam: ATP_bind_1 GTP_EFTU MMR_HSR1 CLP1_P Ras G-alpha cobW MeaB SRP54 Arf AAA_16 FeoB_N AAA_22 NTPase_1 AAA_33 AAA_24 NACHT TsaE SRPRB Zeta_toxin DUF87 Roc FtsK_SpoIIIE PduV-EutP Viral_helicase1 AAA_19 AAA_14 KAP_NTPase AAA_18 MobB AAA_7 AAA_30 PRK NB-ARC AAA_5 Pox_A32 KTI12 Rad17
Other DBs
NCBI-GeneID: 105015462
NCBI-ProteinID: XP_010876948
UniProt: A0A3P8ZKM1
AA seq 398 aa
MATASGSTCPKAVSGENSECDHGGGDSRDSKTTSGNAPQKKPVCLIVLGMAGSGKTTFVQ
RLTAHLHTKKSPPYVINLDPAVHEVPFPANIDIRDTVNYKEVMKQYGLGPNGGIVTSLNL
FATRFDQVMKFIENKQSNHQYVLIDTPGQIEVFTWSASGTIITETLASTFPCVVAYVMDT
SRSVNPVTFMSNMLYACSIMYKTKLPFIVVMNKTDIIDHSFAVEWMQDFEVFQDALNQET
SYVSNLTRSMSLVLDEFYTNLRVVGVSAVTGNGLDQFFAEVAEAAKEYETDYRPEYERLH
KELADAQSRKQQEQMEHLQKDMGSVTMTTTLPTEADVPGRSDLIFNRGNPDEEEEEQVDS
DTDDIDHNLTEESKESTAFGNFLKERKEMVQVRNRKCQ
NT seq 1197 nt   +upstreamnt  +downstreamnt
atggctaccgcgtctgggagcacctgtccgaaagcggtttcaggagaaaatagtgagtgc
gaccacggaggaggcgacagtcgagactcaaagactacttctggcaatgctccacagaag
aaacccgtttgtctcatagtgcttggcatggcgggctctggaaaaactacttttgtgcag
cgactcactgctcaccttcacaccaagaagtctcctccatatgttatcaacctagaccct
gctgtgcatgaagtccctttccctgccaacatcgatatccgtgacacagtgaattacaaa
gaagtgatgaagcaatatggcctaggtcccaatggaggaatcgtcacttcattgaattta
ttcgctacaaggtttgatcaggtcatgaaattcatagagaataaacagtccaatcaccaa
tatgttttgattgacacccctggacagatagaagtgtttacctggtcagcgtctggaacc
atcatcaccgaaactctggcctctactttcccctgtgtcgtggcctacgtgatggacact
tctcgtagtgtcaaccccgtcaccttcatgtccaacatgctctacgcctgcagcattatg
tacaagaccaagctgcccttcatagtcgtgatgaacaagacagacataatcgaccacagc
ttcgccgtggagtggatgcaggacttcgaggtgttccaggacgcgttgaaccaggagacg
tcctatgtcagcaacctgacgcgctccatgagcctggtgctggatgagttctacaccaac
ttacgggtcgtgggcgtttccgcggtcacaggcaacggattagaccagttctttgctgag
gtagcagaggcggcaaaagaatatgagacggattatcgtcctgagtatgaaaggcttcat
aaagagctggcagatgctcagagcagaaagcagcaggagcagatggagcatttacagaag
gacatgggatctgttaccatgacgacgaccctgccgacagaagctgatgtgcctggccgc
agtgatcttatcttcaaccgtggaaaccctgatgaggaagaggaagagcaggtggacagt
gacactgatgacatcgatcacaacttgactgaggagagcaaggagagcacggccttcggg
aacttcctgaaagagaggaaggaaatggtgcaggtacggaacaggaagtgtcagtaa

DBGET integrated database retrieval system