KEGG   Esox lucius (northern pike): 105015740
Entry
105015740         CDS       T04894                                 

Gene name
rpap1
Definition
(RefSeq) RNA polymerase II-associated protein 1 isoform X1
  KO
K20826  RNA polymerase II-associated protein 1
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105015740 (rpap1)
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105015740 (rpap1)
SSDB
Motif
Pfam: RPAP1_C RPAP1_N
Other DBs
NCBI-GeneID: 105015740
NCBI-ProteinID: XP_010877402
AA seq 1404 aa
MAMIKRPKPTDSEADILREQEKFLASGSPSTVNVVRRPDKRAGQSGGADEDQRDVVTIQD
LPDDLPTLTPAPPKKSRLKGERVRFEDEDLEELLDRHDTHISAVLSKIIERDTSSTPVSL
PAFTSLAFPKAFHRPEMENLVPTNGRKRSIFARQTAAQMIPEEKAPMQCAPGWMGPTSGP
GVLNLSPECCVEVEAPPSRLDRFSAMAGPRLVSGQGLGGPGGTAETLQIHQENQAKIQAM
SKDQILEEQQRLLVQLDPRLVDFVRSRKAAGGSAPKSQDARGRKPHLQESVVTGMDTEKA
VEETAEVVMEEEEDEEEPAPQPPMKEEDLPIKPQKDWVHMDKLEPEKLEWIRDLPAPRRK
GTKMAMQARFDFAGTLIPPTEDLPTHLGLHHHGDEPELAGYSLQELFLLSRSQLIQQRSL
ALSTLAHVLTKARAGEFAAALKGSVVSTLLDAGLLFLLRFSLDDSVEGVMSAAVQALRAL
LVSPGDEECLDATLSWLHGLASFPLLPTAEEEEDEEDEGLPEVMRETAEEKEEKKTDHDV
ARHDVVKGVLRMKLLPRLRYILEVVRPSPKVVQDVLAVLIRVARHSSSAATQVLDCPRLM
ETVMSEFVPCSWTVPASPNAQPVYGVPVADAVKLLRVLASAGRHVCARLLNSLGARECLS
RLLAPEPAELQLEPGEALRVSTEAYWLWAVAASYGQACSLYVDLYPVLVKALQSAPWPRS
PSDPLLSLELRRHQALLTLLTHVTHTAGCHQELQAGLVSSQGAECPPPPPVTWGHVMGLQ
PAVLGLLKDCVRTLGDPVQRESTLRLVPSYLLYLGAFYSQLSLQRSFSPVACLQELEKLT
AEVLLPLLSHEAVHSLINNLQSCSAVCNPQSCSPSPETVPSLPGLGCSQWISGGGLAGTS
SPFPLVTSLCYLLDTLISLHKGLVRKFSSLLLFESVLRYLRACGRAKPTPSHWILRHEQH
LLFLLLKLSIRLVPSDPEVAVHATLFHHTSLVMLPWLLPGSEFLAHELMSTMVFNKDFMP
EGQSGGPEAAELSELQLQDRPSPSLQTLGPLLREACVQLPSIRGCYLFHLAHMEPAVLSS
QDYHLGRTPWINTQLLPGLTGPSLPSDWPFLPLVSLYERAGAPDGGGQQVESLPAGSVQS
VTFCLQWLLLLEVWREEALRVVLPVAKLARLACVFLSSSDLFLERPVQRLTWALFRLLTR
PSRLDALDLNSPPPGLASFDDLYSALLGQFEAVSFGDHLFGCFVLLPLQRRYSATMRLKL
FGEHAGLLRSLGVTLEQLAIPIERFTSPPEDSLPLLRLYFRTLVTGALRQCWCPVLYVVA
LSHLNTFIFSQDAGPQQVEAARRSLLRKTHYLTDEVLRSHLLLFRLPQKASELGFDTFDQ
LPPIRQRRLESVLLAKDASDVKVE
NT seq 4215 nt   +upstreamnt  +downstreamnt
atggcgatgataaagcgtcccaagcccactgactccgaggccgacatcctacgagagcag
gagaagttcctggcctccgggtccccatccacagtcaatgtggtcagacgaccggacaag
agagcaggacagtcgggcggggctgatgaagaccagagagatgtggtcacaatccaagat
cttccagatgatctccccactttgactcctgctcctcccaaaaagtctcgcctcaaaggc
gagcgtgttcgcttcgaggatgaggatctggaggagttgctcgaccgacacgacactcac
atcagtgctgttctctccaaaattattgagagggacactagttctactcctgtgtcctta
ccagcattcacaagcctggcttttcccaaagctttccaccggcctgagatggagaacctg
gttccaactaacggtcgtaagaggagcattttcgctagacagactgcagcacagatgata
cctgaggagaaggctcctatgcagtgtgcgccaggatggatgggcccaacttctggaccc
ggtgtcctgaacctttctccagagtgctgcgtggaggtggaagctcctccctcaagactg
gacagattcagcgcgatggcgggccctaggctggtgtctggccagggactgggggggcca
ggcggtacagcggaaactctgcagatccatcaggagaaccaggccaaaatacaggccatg
tctaaagaccagatcctggaggagcagcagaggctgttggtccagctagatcccagactg
gttgacttcgtgaggtctcgtaaggcagcgggaggctccgcccccaagtcccaggatgcc
agaggcaggaaaccacatcttcaagaatccgtcgtgacagggatggacacagagaaggca
gtggaggaaacagcggaggtagtgatggaagaagaggaagatgaggaagaacccgccccg
caaccaccaatgaaagaggaagaccttcccatcaagcctcagaaggactgggtccacatg
gacaagttggagccagagaagctggagtggatcagggatcttcctgctcccagacggaaa
ggaaccaagatggccatgcaggctcgatttgactttgctggaaccctgatcccgcccacg
gaggacctgcccactcaccttggcctgcatcaccatggggatgagcctgagctggcaggt
tactccctgcaggagcttttcctcctgtctcgaagtcagctgatccagcagcgaagcctg
gccctcagcacgctggcccacgtcctcaccaaggcccgagccggggagtttgcagctgcc
ctcaagggcagcgtggtgtccaccctgctggatgccggcctcctcttcctgctgcgcttt
tcgctggacgacagtgtggagggggtgatgtctgccgctgtgcaggcgctccgggcgctc
ctggtgtccccaggcgacgaagagtgtctggacgccaccctgtcatggttacacgggcta
gcttcctttcctctgcttcccaccgctgaggaggaggaggatgaggaagacgagggcctg
ccggaggtcatgagagagacggccgaagagaaggaagagaagaagactgatcacgacgtg
gcaaggcatgatgttgtgaagggtgtactaaggatgaaactgcttccacggcttcgctac
atcctggaggtggttcgcccttcacccaaggtggtccaggacgtgctggcagtcctgatc
cgagtcgccaggcactcttcctccgcggccactcaggtcttggactgcccccgtctgatg
gagactgtgatgtcggagttcgtgccctgctcctggaccgtgcccgcctcgcccaacgcc
cagcctgtgtacggcgtccccgtggccgatgctgtgaagctcctgcgggtactggcctcc
gctggcagacacgtctgtgccaggctgctgaactctctgggcgcgcgggagtgtctgtct
cgcctgctggccccggagcctgcggagctgcagctggagccgggggaggccctgcgggtc
agtacggaggcttactggctctgggctgtggcagccagttacgggcaggcctgcagcctc
tacgtggacctgtaccccgtccttgtgaaggcgttgcagtcggccccctggccccggtcc
ccgtcagaccccctgctgtctctggagctccgcaggcaccaggctctgctcactctgctc
acacacgtcacacacacagccggctgtcatcaggagctgcaggcggggctggtcagttcc
cagggggccgagtgtcctcccccgcccccagtgacatggggtcacgtgatgggtctgcag
cccgctgtgctggggctgttgaaggactgcgtaaggaccctgggggaccctgtccaaagg
gagagcactttgaggctggtcccttcctacctgctctacctgggggccttctactcccag
ctctccctccagaggtcgttcagtccggtggcgtgtctgcaggagctggagaagctgact
gctgaggttcttctccccctgctgtcccacgaggccgttcacagcctgattaacaacctc
cagtcctgctcagccgtttgtaacccccagtcctgctctcccagccctgagaccgtcccc
agtctgccgggcctcggctgctcacagtggatttctggcggaggtctggctggaaccagc
tcccctttccccctcgtcacctccctctgctacctcctggacactctcatcagcctgcac
aaaggcttggtccgcaaattcagctctctgctcctctttgagtctgtgctgcgttacctg
cgtgcctgtggcagagccaagcccaccccgtctcactggatcctgcgtcatgaacagcac
ctactgtttctgctgctgaagctgtccatcaggctggttccctctgacccggaggtggca
gtgcatgcaaccctgttccaccacacgtctctggtgatgcttccctggctcctacctggc
agtgaattcctggctcatgaactcatgtcaaccatggtcttcaacaaagacttcatgcca
gagggtcagagtggaggccccgaggctgcagagctgtctgaattgcagctccaggatcgc
ccctctccttcccttcagaccctgggtcctctgctgagggaagcctgtgtccagctgccc
tccatccggggctgctacctcttccacctggcccacatggagcctgctgtcctctcctcc
caggactaccacctgggccggacgccctggatcaacacccagctcctcccggggctcacc
ggaccctccctaccgtccgattggcccttcctgcccctcgtcagtctgtacgagcgggcg
ggggctccggatggcgggggccagcaggtggagtcgctgcccgctggttcggtgcagtcg
gtcaccttctgcctgcagtggctgttgctcctggaggtctggagggaggaggccctccgg
gtggtgctgcctgttgccaagctggcgcgtctggcctgtgtcttcctgagctccagtgac
ctcttcctggagagaccagtccagaggctgacctgggctctcttcaggctgctgacaagg
ccgtcccggctggatgctctggacctcaactcccctcctccgggcctggcctccttcgac
gacctctattctgccctgttgggacagtttgaggcggtgtcattcggtgaccacctgttt
ggctgctttgtcctcttacccctacagaggcgctacagcgccaccatgaggctgaagctg
tttggggagcatgcgggcctgctgcgctccctgggggtaacactggaacagctggccatc
cccattgagaggttcacgtcacccccagaggattctctgcctctgctgcgcctctacttc
cggacactggtgacgggggcactgaggcagtgctggtgtcctgtgctctacgtggtggcg
ttgtcccacctcaacaccttcatcttctcccaggatgcaggcccccagcaggtggaagca
gcccgtcgcagccttctgaggaagactcactacttgaccgatgaggtgctgaggagccac
ctgctgctcttcaggctgccccagaaggcctctgagctgggctttgacaccttcgaccaa
ctgcctccaatccggcaacgcagactggagagtgttctgcttgccaaggatgcgagtgat
gttaaagtggaatga

DBGET integrated database retrieval system