KEGG   Esox lucius (northern pike): 105015880
Entry
105015880         CDS       T04894                                 

Definition
(RefSeq) dr1-associated corepressor
  KO
K21752  Dr1-associated corepressor
Organism
els  Esox lucius (northern pike)
Brite
KEGG Orthology (KO) [BR:els00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:els03021]
    105015880
Transcription machinery [BR:els03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     105015880
SSDB
Motif
Pfam: CBFD_NFYB_HMF Histone TAF4 HEPN
Other DBs
NCBI-GeneID: 105015880
NCBI-ProteinID: XP_012993002
UniProt: A0A3P9AN20
AA seq 156 aa
MPGQKRKYSVRFPPGRIKKIMQKDTEVGRIATAVPVIISQALEMFLKSLLTKTCQITKSK
HSRVMSITHVKQCIETEKLFDFLKELAEHATMTTKREGRGKGLSIHSHRRKCQEMSVSQQ
NHVEKKPKKANQDTLDNPDSSTDVDSEMYICLGASA
NT seq 471 nt   +upstreamnt  +downstreamnt
atgcctggacagaagagaaagtacagcgtgcgttttccacctggacgcatcaagaaaatc
atgcagaaagatactgaggtgggaagaattgcaacagctgtgcccgtgatcatatctcag
gctttggagatgtttctgaaatccctgttgaccaaaacttgtcagattaccaaatcaaag
cacagcagagtcatgtctatcactcacgtgaagcagtgtatagaaacagagaagctcttc
gactttctcaaggaacttgcagagcatgcaaccatgacaacgaagagggagggtcggggc
aaggggttgtccatacactcacacagaagaaagtgtcaggaaatgtctgtctcccaacag
aatcatgtggaaaagaaacctaaaaaagccaatcaagacaccttggacaacccagacagt
tccactgatgtggattccgagatgtacatctgcttaggagctagtgcatga

DBGET integrated database retrieval system